DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AgaP_AGAP006171

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_316230.4 Gene:AgaP_AGAP006171 / 1276838 VectorBaseID:AGAP006171 Length:677 Species:Anopheles gambiae


Alignment Length:352 Identity:92/352 - (26%)
Similarity:146/352 - (41%) Gaps:89/352 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 KLTDNSEVDRLKDFADEAAPENCECHQQKE----------------PLHTSAAVKNKPRK----- 171
            |.||.:|..:     |..||::......|:                .:.:|::.|..|:.     
Mosquito   259 KSTDAAEPGK-----DNCAPDSSSSDGSKQQASKLNGDLGKVGSSGAVSSSSSAKPSPKNGPPPA 318

  Fly   172 --------------MEDRCVCLDRFGEMYELLDKTTRF-FGVFDGHSGSLSATYATSQLPQLLAD 221
                          .:|.....:.|....|..|.|:.. .|..|...||              |:
Mosquito   319 DVSMSMDDTDDDDDDDDESDSDEEFPHAEEPADDTSSTDEGEEDAEEGS--------------AE 369

  Fly   222 QLKANPDPAAFSPDFYRNAFESAFLLADERFTQKKIT------SGTTSVCALITKDQLYIAWVGD 280
            :.:..||..|...: |.|..::||:        |.||      ||.|:|.||:....||:|..||
Mosquito   370 EEEEEPDEYADMGE-YINEEDAAFM--------KTITDEPGKDSGCTAVVALLHGKDLYVANAGD 425

  Fly   281 SKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDY------S 339
            |:.::......|::...||||:..|.:|||.|||.|. ..|  ||||.||::|:|||:      |
Mosquito   426 SRCVVCRNGKALEMSFDHKPEDTVEYQRIEKAGGRVT-LDG--RVNGGLNLSRAIGDHGYKMNKS 487

  Fly   340 LEA----VIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLI 400
            |.|    :.|.||...:.:....:|:||..||:|:.:....:::.|.:.:....|||..|.:.|.
Mosquito   488 LPAEEQMISALPDIEKITVGPEDEFMVLACDGIWNFMTSEQVVQFVQERINKPGMKLSKICEELF 552

  Fly   401 EAAKERDSQ------DNITAVVVLLKP 421
            :......::      ||:||::|..||
Mosquito   553 DHCLAPHTRGDGTGCDNMTAIIVQFKP 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 82/300 (27%)
AgaP_AGAP006171XP_316230.4 PP2Cc 14..>107 CDD:214625
PP2Cc <385..577 CDD:238083 65/202 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.