DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AgaP_AGAP002953

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_311946.5 Gene:AgaP_AGAP002953 / 1273010 VectorBaseID:AGAP002953 Length:460 Species:Anopheles gambiae


Alignment Length:295 Identity:71/295 - (24%)
Similarity:111/295 - (37%) Gaps:96/295 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 VDRLKDFADEAAPENCECHQQKEPLHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVF 199
            ::::..:||:.  ..||.::.:                :.:|:|:.         |..|..:.:.
Mosquito    29 INQIYKYADDG--RRCEGYESR----------------DKKCLCIS---------DNNTSLYAIL 66

  Fly   200 DGHSGSLSATYATSQL-PQLLADQLK-ANPDPAAFSPDFYRNAFESA------------------ 244
            .||:|...|..|..:: .:||..||. .|.|.|.  .:..|.:|.|.                  
Mosquito    67 SGHNGVTVAENALQEMAAELLLGQLNVCNTDEAV--KELIRQSFMSVEKGYFDSINPHVATKTAI 129

  Fly   245 --FLLAD-----------ERFTQK------KITSGTTSVCALITKDQLYIAWVGDSKALLV---- 286
              .|.||           |...||      .::.|:::|.|||.:..||:..:|:.:|||.    
Mosquito   130 QLHLSADGMNQYEISQQFENVLQKLDSLNNALSVGSSAVLALIHRSHLYLGNIGNCRALLCKTDE 194

  Fly   287 -GKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGI-LNVARSIGDY----------- 338
             ...|..||...|...|.:|..|:...|   |.||   ...|: |...|.||:|           
Mosquito   195 HDTLTVTQLSVDHNLLNAEEAARLFRLG---LMAQ---NFEGVPLYSTRCIGNYLGKAGYKDCNF 253

  Fly   339 ----SLEAVIAEPDFV-DVQLNEAHDFLVLGTDGL 368
                :.|.||.||:.| .:|:..|..||||.:.||
Mosquito   254 LSSATAEPVIFEPEIVGGIQITPACRFLVLMSSGL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 67/270 (25%)
AgaP_AGAP002953XP_311946.5 PP2Cc 52..362 CDD:238083 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.