DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and Pp2d1

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_775625.1 Gene:Pp2d1 / 110332 MGIID:3612067 Length:620 Species:Mus musculus


Alignment Length:307 Identity:65/307 - (21%)
Similarity:110/307 - (35%) Gaps:90/307 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 NKPRKMEDRCVCLDRFGEMYELLDK-TTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPA 230
            |...|.|..|    :|..:.:..|| ...|||:||.|.|..:|..|:.:...||..||... ||:
Mouse   181 NSAWKAEPNC----KFTVVNDFGDKANVCFFGLFDSHYGYAAADLASKEFQVLLLHQLSIQ-DPS 240

  Fly   231 ---------------------------AFSPDF--YR----------NAFESAFLLADE------ 250
                                       |||..:  :|          .||..||...|.      
Mouse   241 YQMTAEQKQLINSFDTVFREEYRAREEAFSSTYKTFRTSRREYEDTHKAFAKAFWRMDRLLRLGR 305

  Fly   251 ------RFT----------------------QKKITSGTTSV----CALITKDQLYIAWVGDSKA 283
                  |::                      :|....|:||:    ...|....|::|..|:.:|
Mouse   306 NETSRVRWSGCSALTCILEGGIKNPHANKDWEKTYQQGSTSLPFQKTPQIISGVLHLANAGNVQA 370

  Fly   284 LLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYS----LEAVI 344
            :|........|.|.|...|..||:|:..:...:........::|.:...|.:|.:.    .:::|
Mouse   371 VLCRNGKGFCLTKEHSTRNTKERRRVLYSEAVISSDDPYGLLDGHIKTTRGLGFHGNLRLKKSII 435

  Fly   345 AEPDFVDVQLNEAHDFLVLGTDGLW---DHVPESLIIETVYDSLADT 388
            ..|..:.|.:::...||:|.|:|||   |....:.::.|::.:..:|
Mouse   436 PAPQTISVPIDDLCQFLILATNGLWQVLDKKEVTALVITLFHAYKET 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 65/307 (21%)
Pp2d1NP_775625.1 PP2Cc 187..472 CDD:238083 61/289 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834841
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.