DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and TAB1

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_006107.1 Gene:TAB1 / 10454 HGNCID:18157 Length:504 Species:Homo sapiens


Alignment Length:305 Identity:78/305 - (25%)
Similarity:124/305 - (40%) Gaps:89/305 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 FGVFDGHSGSLSATYATSQL-PQLLADQLKANPDPAAFSPDFYR---NAF---ESAFL------L 247
            :|||:|:.|:....:...:| .:||..||.|....|    |..|   .||   |.:||      |
Human    65 YGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEA----DVRRVLLQAFDVVERSFLESIDDAL 125

  Fly   248 ADE---------------------------RFTQKKITSGTTSVCALITKDQLYIAWVGDSKALL 285
            |::                           :..:::|:.|..:|.|::..::||:|.||.::|||
Human   126 AEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALL 190

  Fly   286 VGKR------TQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGIL---NVARSIGDYSL- 340
            ....      |||.:  .|..||.||..|:...|   |.| |:.:..||:   ...|.||||.: 
Human   191 CKSTVDGLQVTQLNV--DHTTENEDELFRLSQLG---LDA-GKIKQVGIICGQESTRRIGDYKVK 249

  Fly   341 --------------EAVIAEPDFVDVQ-LNEAHDFLVLGTDGLWD-----HVPESLIIETVYDSL 385
                          :.:||||:....| |:....||||.::||:.     |.|.....|..  ::
Human   250 YGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIA--AM 312

  Fly   386 ADTTM----KLDDIPKLLIEAAKERDSQDNITAVVVLLK--PRHQ 424
            .||..    .||.:.:.:::..| |...|...:.....:  |||:
Human   313 IDTEFAKQTSLDAVAQAVVDRVK-RIHSDTFASGGERARFCPRHE 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 75/296 (25%)
TAB1NP_006107.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
PP2C 69..334 CDD:395385 69/276 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 430..478
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.