DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and pdp2

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_002942040.2 Gene:pdp2 / 100489227 XenbaseID:XB-GENE-480918 Length:536 Species:Xenopus tropicalis


Alignment Length:392 Identity:78/392 - (19%)
Similarity:128/392 - (32%) Gaps:135/392 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KEPLHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLLA 220
            |.|   |..:|.:..::.....|.|| ......|......|||||||:||..|...:.:|...:|
 Frog   105 KNP---STVLKFESNQLASNTPCEDR-RSAATCLQTNGHLFGVFDGHAGSACAQSVSERLFYYIA 165

  Fly   221 DQLKANP--DPAAFSPD------------------FYRN-------------------------A 240
            ..|.:..  :...|:.:                  .||.                         :
 Frog   166 VSLMSQKTLEDIEFASEHLKPMLPILQWHKHKNDHLYREVASLYVDHLRVYWQELINLDNESGMS 230

  Fly   241 FESAFLLADER--------------------FTQKKITSGTTSVCALITKDQLYIAWVGDSKALL 285
            .|.|.:.|.:|                    .|.:...||.|:..:.|....|:||..||.:|:|
 Frog   231 LEDAMVYAFQRLDSDISLEAQVPTNNEFLRNLTLQVAFSGATACVSHIDGIHLHIANSGDCRAIL 295

  Fly   286 -----VGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQW-------RVNGILNVARSIGD- 337
                 .|..:.:.|...|...|..|.:|:...     |...:.       |:.|||...|:.|| 
 Frog   296 GVQDDNGAWSAVPLTADHNAFNKAELQRLNAE-----HPPSEKDTLVTDNRLLGILMPFRAFGDV 355

  Fly   338 ---YSLEA-----------------------------VIAEPDFVDVQLNEAHDFLVLGTDGLWD 370
               :|.|.                             :.|||:....:|.....||::.:|||||
 Frog   356 IFKWSRELQKSVLLNACDLEPLNIYQYSPSNYHTPPYLSAEPEVTYHKLRPQDKFLIMASDGLWD 420

  Fly   371 HVPESLIIETVYDSLADTTMK----------LDDIPKLLI--EAAKERDSQDNITAVVVLLKPRH 423
            .:....:::.|.:.|.:..::          |.::..||:  ::.|......||...::    ||
 Frog   421 MLENEQVVKLVANHLLENFLQEPELSAQKRSLGNMHNLLLNRQSKKVPVPDQNIATHLI----RH 481

  Fly   424 QI 425
            .|
 Frog   482 AI 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 73/380 (19%)
pdp2XP_002942040.2 PP2Cc 113..521 CDD:238083 74/381 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.