powered by:
Protein Alignment CG10376 and rps15a
DIOPT Version :9
Sequence 1: | NP_609899.1 |
Gene: | CG10376 / 35126 |
FlyBaseID: | FBgn0032702 |
Length: | 428 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001096489.1 |
Gene: | rps15a / 100125111 |
XenbaseID: | XB-GENE-981311 |
Length: | 130 |
Species: | Xenopus tropicalis |
Alignment Length: | 94 |
Identity: | 18/94 - (19%) |
Similarity: | 33/94 - (35%) |
Gaps: | 42/94 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 291 QLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSLEAVIAEPDFVDVQLN 355
:.:::..|: ||..|::..|:....|::: |.| ||||.
Frog 49 EFEIIDDHR------------AGKIVVNLTGRLNKCGVIS----------------PRF-DVQLK 84
Fly 356 EAH------------DFLVLGTD-GLWDH 371
:.. .::||.|. |:.||
Frog 85 DLEKWQNNLLPSRQFGYIVLTTSAGIMDH 113
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165164272 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.