DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and rps15a

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001096489.1 Gene:rps15a / 100125111 XenbaseID:XB-GENE-981311 Length:130 Species:Xenopus tropicalis


Alignment Length:94 Identity:18/94 - (19%)
Similarity:33/94 - (35%) Gaps:42/94 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 QLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSLEAVIAEPDFVDVQLN 355
            :.:::..|:            ||..|::..|:....|:::                |.| ||||.
 Frog    49 EFEIIDDHR------------AGKIVVNLTGRLNKCGVIS----------------PRF-DVQLK 84

  Fly   356 EAH------------DFLVLGTD-GLWDH 371
            :..            .::||.|. |:.||
 Frog    85 DLEKWQNNLLPSRQFGYIVLTTSAGIMDH 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 18/94 (19%)
rps15aNP_001096489.1 PTZ00158 1..130 CDD:185487 18/94 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165164272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.