DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ilkap

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001082973.2 Gene:ilkap / 100037350 ZFINID:ZDB-GENE-070410-122 Length:345 Species:Danio rerio


Alignment Length:350 Identity:100/350 - (28%)
Similarity:150/350 - (42%) Gaps:76/350 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 DRLKDFADEAAPENCECHQQKEPLHTSAAVKN---KPRKMEDRCVCLDRF-----------GEMY 186
            |.|.:..:|.||...:..::.|....|.:.:.   :..|.|::.||.:.|           ||..
Zfish     5 DDLPEPTNEPAPVKLQQEERGEKRKRSISSEQTEVQDDKQEEKKVCKEGFAKLTGFVSARRGERE 69

  Fly   187 ELLD---------------KTTR--FFGVFDGHSGSLSATYATSQLPQLLADQLK----ANPDPA 230
            |:.|               :.:|  :|.|||||.|:.::.:|...|...|..:..    .|.|  
Zfish    70 EMQDAHVLLPDLNITCLPSQVSRLAYFAVFDGHGGARASQFAAENLHHTLLSKFPKGDVENLD-- 132

  Fly   231 AFSPDFYRNAFESAFLLADERFTQKKIT------SGTTSVCALITKDQLYIAWVGDSKALLV--- 286
                ...|......|...||.|.:|..:      .|:|:.|.|...|.||:|.:|||:|:|.   
Zfish   133 ----KLVRKCLLDTFRQTDEDFLKKASSQKPAWKDGSTATCLLAVDDVLYVANLGDSRAVLCRME 193

  Fly   287 -----GKR--TQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGD--YSLEA 342
                 |||  ..|.|.|.|.|...:||.||:.|||||...    ||.|:|.|:|||||  |....
Zfish   194 QAKDSGKRKCVTLALSKEHNPTIYEERMRIQRAGGTVRDG----RVLGVLEVSRSIGDGQYKRCG 254

  Fly   343 VIAEPDFVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDD------------I 395
            ||:.||....||:....|::|..|||:........::.|...|.:.|::|.:            .
Zfish   255 VISTPDLRRCQLSPNDKFVLLACDGLFKVFSADEAVQFVLGVLENETVELKEGQSEGAGLFEAAC 319

  Fly   396 PKLLIEAAKERDSQDNITAVVVLLK 420
            .:|..||.: |.|.||:|.::|.::
Zfish   320 QRLASEAVR-RGSADNVTVILVSIE 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 94/323 (29%)
ilkapNP_001082973.2 PP2Cc 59..342 CDD:238083 88/293 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.