DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and ppm1bb

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_005156321.1 Gene:ppm1bb / 100003481 ZFINID:ZDB-GENE-041114-185 Length:475 Species:Danio rerio


Alignment Length:287 Identity:83/287 - (28%)
Similarity:141/287 - (49%) Gaps:57/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 QKEPLHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQLL 219
            :.|..||  ||...|..::|                  ..||.|:|||:||..|.|.:..|.:.:
Zfish    35 EMEDAHT--AVVGLPHGLDD------------------WSFFAVYDGHAGSRVANYCSKHLLEHI 79

  Fly   220 ---ADQLKANPDPAAFSPDFYRNAFESAFLLADE---RFTQKK---ITSGTTSVCALITKDQLYI 275
               ::..::.||    |.:..:....|.||..||   .|:..:   ..||:|:|..|::.:.||.
Zfish    80 ITSSEDFRSGPD----SVEGVKIGIRSGFLKIDEYMRNFSDLRNGMDRSGSTAVGVLVSPEHLYF 140

  Fly   276 AWVGDSKALLVGKRTQLQL-VKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYS 339
            ...|||:|:| .:..|::. .:.|||.||.|::||:.|||:|:..    ||||.|.|:|::|||.
Zfish   141 INCGDSRAVL-SRAGQVRFSTQDHKPCNPREKERIQNAGGSVMIQ----RVNGSLAVSRALGDYD 200

  Fly   340 L----------EAVIAEPDFVDV-QLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLD 393
            .          :.|..||:..:| ::::..:|:||..||:||.:..    |.:.|.:.......|
Zfish   201 YKCVDGKGPTEQLVSPEPEVFEVPRVSDEDEFVVLACDGIWDVMSN----EELCDFVRSRLEVWD 261

  Fly   394 DIPKL---LIEAAKERDSQDNITAVVV 417
            |:.|:   :::....:.|:||::.|:|
Zfish   262 DLEKVCNSVVDTCLHKGSRDNMSVVLV 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 82/282 (29%)
ppm1bbXP_005156321.1 PP2Cc 24..290 CDD:238083 83/287 (29%)
PP2C_C 284..360 CDD:285117 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577920
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.