DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10338 and RUS6

DIOPT Version :9

Sequence 1:NP_001286056.1 Gene:CG10338 / 35124 FlyBaseID:FBgn0032700 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_568713.1 Gene:RUS6 / 835045 AraportID:AT5G49820 Length:497 Species:Arabidopsis thaliana


Alignment Length:436 Identity:117/436 - (26%)
Similarity:191/436 - (43%) Gaps:49/436 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GEEILYVTPADQS-----NIVR-VPLRGDKLVIQEKFLLFRVLQKVFLPKGYPDSVSEDYAAYQI 71
            |....||..:|.|     |.|| :.|...:....|   :...|:...:|:|:|.||:|.|..|..
plant    69 GRRFKYVAESDGSGRFKKNSVRAISLESPQTPFDE---VGSFLRSYVVPEGFPGSVNESYVPYMT 130

  Fly    72 WDTAQAFCSTICGTLCTHAILKGIGVGSENINAFSATA-TWILKEGSGHVGRIVFAWWQGSQLDV 135
            |...:.|.....|...|..:|..:| .|.|.:|.:|.| .||||:|:|.||:::|| .||.:.|.
plant   131 WRALKHFFGGAMGVFTTQTLLNSVG-ASRNSSASAAVAINWILKDGAGRVGKMLFA-RQGKKFDY 193

  Fly   136 DSKKWRLRADFLNDLAMGIEIYVLPKYPHFSTQILCCSTLLKAIVGVAGGATRSALTQHHALRGN 200
            |.|:.|...|.|.:|..|:|: .....||....:.|.:.::|.:..|...:||:.:.:..|...|
plant   194 DLKQLRFAGDLLMELGAGVEL-ATAAVPHLFLPLACAANVVKNVAAVTSTSTRTPIYKAFAKGEN 257

  Fly   201 LADVASKDSSQETCVNLVASFVGL-YLLSLIKSQAVLYTIFYVVVSLHLYANLKAVRAVCLRSFN 264
            :.||.:|..    ||..:|..:|. :.:.:.|....|.|.|.::...:|.::.:.||:|.|.:.|
plant   258 IGDVTAKGE----CVGNIADLMGTGFSILISKRNPSLVTTFGLLSCGYLMSSYQEVRSVVLHTLN 318

  Fly   265 ESRYLIALEEFFRSSRMLSPQQVNAMERVTVGQTVSVSLNIKLGLSVKNLIDEYKSSSVIENIVS 329
            .:|:.:|:|.|.::.|:.|.|:.|..|::.....|. ...:.||...|   |.::..|....:..
plant   319 RARFTVAVESFLKTGRVPSLQEGNIQEKIFTFPWVD-DRPVMLGARFK---DAFQDPSTYMAVKP 379

  Fly   330 SFDPHEHFI-IAQTKKCLGVYLHFETRPQDVLKAYFFAVSYLQDRNQLK---------------- 377
            .||...:.: .:.||..:...|..:....|:|||.|.|...|...||.|                
plant   380 FFDKERYMVTYSPTKGKVYALLKHQANSDDILKAAFHAHVLLHFMNQSKDGNPRSVEQLDPAFAP 444

  Fly   378 ----------EKYWDIQTKWQEFLALAQQEGWLIHHHLLLVDEYRL 413
                      |....:.|.:..|.:.|.::||.:...||.....||
plant   445 TEYELESRIAESCEMVSTSYGVFKSRAAEQGWRMSESLLNPGRARL 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10338NP_001286056.1 DUF647 40..279 CDD:282708 72/240 (30%)
RUS6NP_568713.1 DUF647 104..333 CDD:398514 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1357597at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102741
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.680

Return to query results.
Submit another query.