DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10383 and CG5455

DIOPT Version :9

Sequence 1:NP_001286055.1 Gene:CG10383 / 35123 FlyBaseID:FBgn0032699 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_651481.1 Gene:CG5455 / 43196 FlyBaseID:FBgn0039430 Length:688 Species:Drosophila melanogaster


Alignment Length:560 Identity:143/560 - (25%)
Similarity:231/560 - (41%) Gaps:148/560 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 EVSARLMRDGGLVHLMELRKIFNDDN-----ETLS------TLCKVLANMSLVPDAVEHFFTSGW 300
            :||.|:   |.|:.|:::||  :.|.     :|||      |.|.....|...|     |:|   
  Fly   201 QVSNRM---GPLLKLLKMRK--SQDGLESLPDTLSAPSTPCTPCPTSNPMQGPP-----FYT--- 252

  Fly   301 VGALAEWQQCPDLRLQVISAKTMANLDHDDPNQCTY-----PPNVYPLHPRVRTRRKPKADIVFV 360
                                     :..|.||.||.     ||...|:          :||||.:
  Fly   253 -------------------------VRSDAPNCCTINILAEPPPGQPI----------RADIVLI 282

  Fly   361 HGLLGGVFITWR----QRDRKPTELGLYGKNAFYTSETDDVFLVGEQKRLSGGKLKPG---EAVK 418
            |||.|.:..||:    |.||:|.|        |.......|......:......:.|.   :..|
  Fly   283 HGLHGSLVNTWKQGLWQNDRQPVE--------FERPPRPPVRPPKRPRHSRSAAIHPAPREKRAK 339

  Fly   419 NVNGNQKTETIKD-PVLKASK-------KVEEQRLNISDAATKEFV------------------- 456
            ..:.|:..:|..| ||.:.::       :.|:.::|.||:...::.                   
  Fly   340 FASLNRCMDTPDDSPVRRRTRLQKSMPMQPEDFQINASDSDDSDYAYVCGEPEEIQICEGIEYSF 404

  Fly   457 ETLR---------NEAELDSDWEVVHPDVPLNANEE--CEGKFS-----------VCGSEWRNQD 499
            .|.|         .:|||:|..:.       |.|||  ..||.:           ....:.:...
  Fly   405 PTFRLRMQDNSRLLQAELESMLQA-------NGNEEGGTNGKDNRPRPPSPATPRKAARKSKPSP 462

  Fly   500 TSEEYTNCWPMEWLPDDYPDSRILGIDYTSAVTEWSANFTKYCPCEKGQGHIDVRANTLLDRISA 564
            ....|:.|||.:|||.|.|..|::.::||:....|...:....|    :..:..|:..:.:.:..
  Fly   463 NDPNYSKCWPGDWLPLDCPGVRVIALNYTTDQYLWRPLWKSKEP----RSSLIQRSREMAELLIQ 523

  Fly   565 SDVGNDRPIVWIGHSMGGLLTKLILLKSLDSQEPKVQQLTKNTKGIVFLGTPHRGSPIAKWKQHM 629
            ..||:.|||:::|||.|||..|.:::.:.:|..|.:..|.::.:|..|...|||||.:|..|   
  Fly   524 HRVGHGRPIIYVGHSKGGLFIKQLMVDAWESGRPAMTPLWRSARGCFFYSVPHRGSHLASIK--- 585

  Fly   630 QMILSPSIEVKEMEENSPKLLEMHRRFMGCLHTLLRHVK--VVSVAEGSPTMLTSFKFPLRIVTE 692
            ..:||.|:|:.|:|:|:..||::||||.|..|  |.|:|  |.|..|.:.|:::...  ||||..
  Fly   586 APLLSRSVELLEIEKNNKYLLDLHRRFAGLYH--LGHLKIEVFSFVETALTLMSVLY--LRIVGV 646

  Fly   693 ESSKIDFGDFYLLKDDHLSLSKPIYRQSFLYQRLLHVIRE 732
            :|:....||...::.||..:.||..|...||:.|:.:|.:
  Fly   647 DSADPGIGDVCGIRLDHREICKPRGRDCILYKELVKMIEK 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10383NP_001286055.1 Abhydrolase <522..>642 CDD:304388 33/119 (28%)
CG5455NP_651481.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1311762at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3351
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.