DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tos and RAD27

DIOPT Version :9

Sequence 1:NP_477145.1 Gene:tos / 35119 FlyBaseID:FBgn0015553 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_012809.1 Gene:RAD27 / 853747 SGDID:S000001596 Length:382 Species:Saccharomyces cerevisiae


Alignment Length:416 Identity:101/416 - (24%)
Similarity:167/416 - (40%) Gaps:93/416 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGITGLIPFVGK-ASSQLHLKDIR---GSTVAVDTYCWLHKGVFGCAEK------LARGEDTDVY 55
            |||.||...:.: ..|.:...||:   |..||:|....|::.:....::      ...||.|...
Yeast     1 MGIKGLNAIISEHVPSAIRKSDIKSFFGRKVAIDASMSLYQFLIAVRQQDGGQLTNEAGETTSHL 65

  Fly    56 IQYCLKYVNMLLSYDIKPILVFDGQ--HLPAKALTEK--RRRDSRKQSKERAAELLRLGRIEEAR 116
            :....:.:.| :...|||..||||:  .|.:..||::  ||.::.|:..|...||       |..
Yeast    66 MGMFYRTLRM-IDNGIKPCYVFDGKPPDLKSHELTKRSSRRVETEKKLAEATTEL-------EKM 122

  Fly   117 SHMRRCVDVT---HDMALRLIRECRSRNVDCIVAPYEADAQMAWLNRADVAQYIITEDSD----- 173
            ...||.|.|:   ::.|.:|:   ....:..|:||.||:||.|.|.:........:||.|     
Yeast   123 KQERRLVKVSKEHNEEAQKLL---GLMGIPYIIAPTEAEAQCAELAKKGKVYAAASEDMDTLCYR 184

  Fly   174 -------LTLFGAK-----NIIFKLDLNGSGLLVEAEKLHLAMGCTEEKYHFDKFRRMCILSGCD 226
                   ||...||     .|..:|.|.|..|.:|                  :|..:||:.|||
Yeast   185 TPFLLRHLTFSEAKKEPIHEIDTELVLRGLDLTIE------------------QFVDLCIMLGCD 231

  Fly   227 YLDSLPGIGLAKACKFILKT-----------EQEDMRIALKKIPS---YLNMRNLEVDDDYIENF 277
            |.:|:.|:|...|.| ::||           |..:......|||.   |...|.|.:|.:.|:. 
Yeast   232 YCESIRGVGPVTALK-LIKTHGSIEKIVEFIESGESNNTKWKIPEDWPYKQARMLFLDPEVIDG- 294

  Fly   278 MKAEATFRHMFIYNPLERR--MQRLCALEDYETDERYCSNAGTLLEDSEQALHLALGNLNPF--S 338
              .|...:    ::|.:.:  ::.||..:.: ::||..|....|.:..:..:.   |.|:.|  .
Yeast   295 --NEINLK----WSPPKEKELIEYLCDDKKF-SEERVKSGISRLKKGLKSGIQ---GRLDGFFQV 349

  Fly   339 MKRLDSWTPEKAWPTPKNVKRSKHKS 364
            :.:........|....:|.|.:|:|:
Yeast   350 VPKTKEQLAAAAKRAQENKKLNKNKN 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tosNP_477145.1 PIN_EXO1 1..204 CDD:189027 62/236 (26%)
H3TH_EXO1 214..291 CDD:188628 24/90 (27%)
RAD27NP_012809.1 PTZ00217 1..364 CDD:240317 97/403 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.