DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp310a1 and CYP89A7

DIOPT Version :9

Sequence 1:NP_609891.1 Gene:Cyp310a1 / 35115 FlyBaseID:FBgn0032693 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_176673.1 Gene:CYP89A7 / 842801 AraportID:AT1G64930 Length:511 Species:Arabidopsis thaliana


Alignment Length:449 Identity:87/449 - (19%)
Similarity:172/449 - (38%) Gaps:104/449 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RPVLLVRNVELAQTILQQSNGHFSE------------------------LKWDYISGYRRFNLLE 114
            ||.:.|.:..||...|..:...|::                        :.|..:    |.|:.|
plant    77 RPAIFVADGSLAHQALVLNGAVFADRPPAAPISKILSNNQHTITSCLYGVTWRLL----RRNITE 137

  Fly   115 KLAPMFGTKRLSEMFGQVQKVGDHLIHHLL----DR-QGQGCPQEVDIQQKLRVYSVNIIANLIY 174
            .|.|       |.|     |...|:.|.:|    || :..|..:.:.:...|......::..:.:
plant   138 ILHP-------SRM-----KSYSHVRHWVLEILFDRLRKSGGEEPIVVFDHLHYAMFAVLVLMCF 190

  Fly   175 G--LDINNFEHEDHILTS-YLSHSQASIQSFTLGRLPQKSSYTYRLRDLIKQSVELREDHGLIRK 236
            |  ||....:..:::... .|..::.||    |...|:.:....|.|  .::..::|.:    ::
plant   191 GDKLDEKQIKQVEYVQRQMLLGFARYSI----LNLCPKFTKLILRKR--WEEFFQMRRE----QQ 245

  Fly   237 DILQLLV----------RFRNGNEVSGDKWQLE---------PINDADKLLSIKRLAKVAEDLLK 282
            |:|..|:          :.|:..|...:|..::         .:.|..:.|:...:..:..:.|.
plant   246 DVLLRLIYARRKIVEERKKRSSEEEEENKEYVQSYVDTLLDVELPDEKRKLNEDEIVSLCSEFLI 310

  Fly   283 VSLDAVASTVTFTLLEILQEPLIVEKLRAEIKELSNENGQLKFE-ELNGLRYMDMCLKETLRKYP 346
            ...|..|:.:.:.:..:::...|.|:|..||..:..|..::..| :...:.|:...:.|.||::|
plant   311 AGSDTTATVLQWIMANLVKNQEIQERLYEEITNVVGEEAKVVEEKDTQKMPYLKAVVMEALRRHP 375

  Fly   347 P----LP--IIERVCRKSYSLPNS---KFTIDEGKTLMVPLLAMHRDEKYFSEPMKYKPLRFL-- 400
            |    ||  :.|......|.:|..   .|.:.|          :.||.|.:.|||.:||.||:  
plant   376 PGNTVLPHSVTEDTVLGGYKVPKKGTINFLVAE----------IGRDPKVWEEPMAFKPERFMGE 430

  Fly   401 QTANDVGQCEDKTKSNVFIGFGIGGSQCVGQNFAKLVIKVALIKLLQNFH-LELDANQV 458
            :.|.|:    ..::....:.||.|...|.|...|.|.::..:..:::.|. .|::.::|
plant   431 EEAVDI----TGSRGIKMMPFGAGRRICPGIGLAMLHLEYYVANMVREFQWKEVEGHEV 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp310a1NP_609891.1 p450 69..454 CDD:299894 86/443 (19%)
CYP89A7NP_176673.1 CYP77_89 65..502 CDD:410698 87/449 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.