DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp310a1 and CYP714A2

DIOPT Version :9

Sequence 1:NP_609891.1 Gene:Cyp310a1 / 35115 FlyBaseID:FBgn0032693 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_197872.1 Gene:CYP714A2 / 832559 AraportID:AT5G24900 Length:525 Species:Arabidopsis thaliana


Alignment Length:518 Identity:108/518 - (20%)
Similarity:203/518 - (39%) Gaps:124/518 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VRHIYS--------HWRRRGFPSEKAGITWSF----LQKAYRREFRHVEAICEAYQSGK---DRL 66
            :.|.||        |||:      :.|..:::    .|..|   ..|.|.:.|..|:..   .|:
plant    78 ISHDYSSSLFPHFDHWRK------QYGRIYTYSTGLKQHLY---INHPEMVKELSQTNTLNLGRI 133

  Fly    67 LGIYCFFRPVLLVRNVELAQTILQQSNGHFS--------ELKWDYISGYRRFNLLEKLAPMFGTK 123
            ..|.....|:       |...|:..:..|::        |...|.|.|.... ::|...||.  .
plant   134 THITKRLNPI-------LGNGIITSNGPHWAHQRRIIAYEFTHDKIKGMVGL-MVESAMPML--N 188

  Fly   124 RLSEMFGQVQKVGDHLIHHLLDRQGQGCPQEVDIQQKLRVYSVNIIANLIYGLDINN----FEHE 184
            :..||   |::.|:           .||  ::.:.:.|:..|.::||...:|...:.    |...
plant   189 KWEEM---VKRGGE-----------MGC--DIRVDEDLKDVSADVIAKACFGSSFSKGKAIFSMI 237

  Fly   185 DHILTSYL-------------------SHSQASIQSFTLGRLPQKSSYTYRLRDLIKQSVELRED 230
            ..:||:..                   .|....|.:.   .:..:||....:::   :.:|.::.
plant   238 RDLLTAITKRSVLFRFNGFTDMVFGSKKHGDVDIDAL---EMELESSIWETVKE---REIECKDT 296

  Fly   231 HGLIRKDILQLLVRFRNG--NEVSGDKWQLEPINDADKLLSIKRLAKVAEDLLKVSLDAVASTVT 293
            |   :||::||::   .|  ....|:.|        ||....:.:....:.:.....|:.|.:|:
plant   297 H---KKDLMQLIL---EGAMRSCDGNLW--------DKSAYRRFVVDNCKSIYFAGHDSTAVSVS 347

  Fly   294 FTLLEILQEPLIVEKLRAEIKELSNENGQLKFEELNGLRYMDMCLKETLRKYPPLPIIERVCRKS 358
            :.|:.:...|....|:|.||.. |.:||....|.:..|:.:.|.::||:|.|||.||:.|...|.
plant   348 WCLMLLALNPSWQVKIRDEILS-SCKNGIPDAESIPNLKTVTMVIQETMRLYPPAPIVGREASKD 411

  Fly   359 YSLPNSKFTIDEGKTLMVPLLAMHRD-EKYFSEPMKYKPLRFLQTANDVGQCEDKTKSNVFIGFG 422
            ..|  ....:.:|..:...:.|:||| |.:..:...:||.||.:..:..  |:   ....:|.||
plant   412 IRL--GDLVVPKGVCIWTLIPALHRDPEIWGPDANDFKPERFSEGISKA--CK---YPQSYIPFG 469

  Fly   423 IGGSQCVGQNFAKLVIKVALIKLLQNFHLELDANQVKTLKVSHRPAP----FIHTKDGLKVKL 481
            :|...|||:||..:.:||.:..::..|..        ||..:::.:|    .:..:.|:.:::
plant   470 LGPRTCVGKNFGMMEVKVLVSLIVSKFSF--------TLSPTYQHSPSHKLLVEPQHGVVIRV 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp310a1NP_609891.1 p450 69..454 CDD:299894 90/418 (22%)
CYP714A2NP_197872.1 p450 37..524 CDD:299894 108/516 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.