DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp310a1 and CYP71A27

DIOPT Version :9

Sequence 1:NP_609891.1 Gene:Cyp310a1 / 35115 FlyBaseID:FBgn0032693 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_193757.3 Gene:CYP71A27 / 827771 AraportID:AT4G20240 Length:451 Species:Arabidopsis thaliana


Alignment Length:321 Identity:69/321 - (21%)
Similarity:122/321 - (38%) Gaps:75/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 IANLIYGLDINNFEH----EDHILTSYLSHSQASIQS-----------------FTLGRLPQKSS 212
            :.:|:....:.:||:    |..::|..|..:.:|..|                 .||||...:..
plant   133 VVHLLNNKMVRSFENLREEEIKVMTEKLEEASSSSSSVNLSKLLMTLTNDIICRITLGRKYNEEE 197

  Fly   213 YTYRLRDLIKQSVEL---------------------REDHGLIRKDILQLLVRFRNG---NEVSG 253
            ....:::|:..|.|.                     .:|.   .|||...|..|.:.   ..|..
plant   198 GGIDIKNLVMTSSEFFGKFFFGDFIPSLAWIDWISGIDDK---MKDINNKLDCFLDSMVQEHVDA 259

  Fly   254 DKWQLEPINDADKLLSI-----KRLAKVAEDLLKVSLD-------AVASTVTFTLLEILQEPLIV 306
            |  ..||.:..|.||.|     ||......||:.:..|       ..||.:.:|:.|:::.|..:
plant   260 D--HKEPSDFIDMLLLIQKDKTKRFKFDRSDLILILKDMFFSGTATTASQLEWTMTELMRHPECM 322

  Fly   307 EKLRAEIKELSNENGQLKFEELNGLRYMDMCLKETLRKYPPLPIIERVCRKSYSLPNSKFTIDEG 371
            :||:.||...|..|..:..:|:..:.|:...:||.||.:|..|::.|:..:...|..  :.|..|
plant   323 KKLQDEINSFSTHNLNVTEKEVEKMNYLHCVIKEGLRLHPSGPLLFRLPSEDVQLKG--YDISAG 385

  Fly   372 KTLMVPLLAMHRDEKYFS-EPMKYKPLRFLQTAND----------VGQCEDKTKSNVFIGF 421
            ..:::...|:.|:...:. :..:|:|.|...|..|          :.|.||....:.|:.|
plant   386 THVIINAWALQRNPAIWGLDANEYRPERHFGTNLDFNVLIPNSFHLEQGEDFALESDFLWF 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp310a1NP_609891.1 p450 69..454 CDD:299894 69/321 (21%)
CYP71A27NP_193757.3 p450 33..439 CDD:299894 67/312 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.