DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp310a1 and TBXAS1

DIOPT Version :9

Sequence 1:NP_609891.1 Gene:Cyp310a1 / 35115 FlyBaseID:FBgn0032693 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001159725.2 Gene:TBXAS1 / 6916 HGNCID:11609 Length:579 Species:Homo sapiens


Alignment Length:539 Identity:103/539 - (19%)
Similarity:193/539 - (35%) Gaps:156/539 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LLGIYCFFRPVLLVRNVELAQTILQQSNGHFS--------------------ELKWDYISGYRRF 110
            |.|.|...|..:::...::.:.:|.::..:|:                    :.:|:.:.|    
Human    77 LCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRG---- 137

  Fly   111 NLLEKLAPMFGTKRLSE-------------MFGQ------------------------------- 131
                .|...|..::|:|             |.||                               
Human   138 ----ALMSAFSPEKLNELGLLIMQERIKGHMGGQQAPQRIPPTRLSKPSGIYVNLHYATLPFCMV 198

  Fly   132 --VQKVGDHLIHHLLDRQGQGCPQEVDIQQKLRVYSVNIIANLIYGLDINNFE-HED----H--- 186
              :.:..|.|:.||......|  ...|||:....|:.:::|::.:|..::::: .||    |   
Human   199 PLISQACDLLLAHLKRYAESG--DAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKR 261

  Fly   187 ---------ILTSYLSHSQASIQSFTLGR-LPQKSSYTYRLRD--------LIKQSVELREDHGL 233
                     ||...||.....:   .|.| ||.|:      ||        ||:..:.||:....
Human   262 FFEFCIPRPILVLLLSFPSIMV---PLARILPNKN------RDELNGFFNKLIRNVIALRDQQAA 317

  Fly   234 --IRKDILQLLVRFRNGNEVSGDKWQLEPINDAD-------------------------KLLSIK 271
              .|:|.||:::..|:.....|       :.|.|                         :.|::.
Human   318 EERRRDFLQMVLDARHSASPMG-------VQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVD 375

  Fly   272 RLAKVAEDLLKVSLDAVASTVTFTLLEILQEPLIVEKLRAEIKELSNENGQLKFEEL-NGLRYMD 335
            .:...|...|....:.:.:|::|....:...|...|||..|:.....::...:|..| .||.|:|
Human   376 EIVGQAFIFLIAGYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLD 440

  Fly   336 MCLKETLRKYPPLPIIERVCRKSYSLPNSKFTIDEGKTLMVPLLAMHRDEKYFSEPMKYKPLRFL 400
            |.:.||||.|||.....|...:...:...:  |..|..|.:.:.|:|.|.:::..|..:.|.|| 
Human   441 MVIAETLRMYPPAFRFTREAAQDCEVLGQR--IPAGAVLEMAVGALHHDPEHWPSPETFNPERF- 502

  Fly   401 QTANDVGQCEDKTKSNVFIGFGIGGSQCVGQNFAKLVIKVALIKLLQNFHLELDANQVKTLKVSH 465
                 ..:...:.:...::.||.|...|:|.....|.:|:.|:.:|..|..:........|::..
Human   503 -----TAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLES 562

  Fly   466 RPAPFIHTKDGLKVKLKRR 484
            :.|  :..|:|:.:|:..|
Human   563 KSA--LGPKNGVYIKIVSR 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp310a1NP_609891.1 p450 69..454 CDD:299894 95/504 (19%)
TBXAS1NP_001159725.2 p450 47..576 CDD:306555 101/534 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.