DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp310a1 and CYP705A28

DIOPT Version :9

Sequence 1:NP_609891.1 Gene:Cyp310a1 / 35115 FlyBaseID:FBgn0032693 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001154631.1 Gene:CYP705A28 / 3768880 AraportID:AT3G20935 Length:348 Species:Arabidopsis thaliana


Alignment Length:256 Identity:69/256 - (26%)
Similarity:122/256 - (47%) Gaps:30/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 LIKQSVELREDHGLIRKDILQLL-----VRFRNGN----EVSGDKWQLEPINDADKLLSIKRLAK 275
            |::...::.||| ....|::.||     :|.:|.|    .||..|.:..||        :.|..|
plant    68 LVEHEEKMEEDH-YKANDMMDLLLEAMEMRMQNVNLCIKRVSNTKARKPPI--------LFRYGK 123

  Fly   276 ------VAEDLLKVSLDAVASTVTFTLLEILQEPLIVEKLRAEIKELSNENGQLKFEELNGLRYM 334
                  :.::||....|..|....:|:.|::..|.|:|:||.||:.:......::..:|:.|.|:
plant   124 YSNNSLLLQELLVAGTDTSALATQWTMAELINNPTILERLREEIESVVGNTRLIQETDLSNLPYL 188

  Fly   335 DMCLKETLRKYPPLPIIERVCRKSYSLPNSKFTIDEGKTLMVPLLAMHRDEKYFSEPMKYKPLRF 399
            ...:||.||.:||..|..|:.::...|  ..|.|.|...|:|...|:.||..::.:|.::||.||
plant   189 QSVVKEGLRLHPPASISVRMSQERCEL--GGFYIPEKTLLVVNTYAIMRDPNFWEDPEEFKPERF 251

  Fly   400 LQTANDVGQCEDKTKSNV--FIGFGIGGSQCVGQNFAKLVIKVALIKLLQNFHLELDANQV 458
            :.::.  .:.||:.:..|  :|.|..|...|.|.|.|.:.:.:|:..::|.|...:...:|
plant   252 ITSSR--SEQEDEMREEVLKYIPFSAGRRGCPGSNLAYVSLGIAIGVMVQCFDWRIKGEKV 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp310a1NP_609891.1 p450 69..454 CDD:299894 68/250 (27%)
CYP705A28NP_001154631.1 p450 <13..346 CDD:299894 69/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.