DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp310a1 and Cyp6a9

DIOPT Version :9

Sequence 1:NP_609891.1 Gene:Cyp310a1 / 35115 FlyBaseID:FBgn0032693 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster


Alignment Length:533 Identity:124/533 - (23%)
Similarity:237/533 - (44%) Gaps:89/533 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLPILLYSAVFLSVRHIYSHWRRRGFPSEKAGI------------TWSFLQKAYRREFRHVEAI 55
            |.:.::|...:.|..|....:|:....|.|:..|            ::|.:...|..:||     
  Fly     8 LAIVVVLVGYLLLKWRRALHYWQNLDIPCEEPHILMGSLTGVQTSRSFSAIWMDYYNKFR----- 67

  Fly    56 CEAYQSGKDRLLGIYCFFRPVLLVRNVELAQTILQQSNGHFSELKWDY-------------ISGY 107
                  |.....|.|.|.||.:||.::.||:.||.:....|::..:.:             :.|.
  Fly    68 ------GTGPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTDRGFYHNTEDDPLSGQLFLLDGQ 126

  Fly   108 RRFNLLEKLAPMFGTKRLSEMFGQVQKVGDHLIHHLLDRQGQGCPQE--VDIQQKLRVYSVNIIA 170
            :..::..||:..|.:.::..||..|.|||    |..::..||...:.  |:::..|..::.::|.
  Fly   127 KWKSMRSKLSYTFTSGKMKYMFPTVVKVG----HEFIEVFGQAMEKSPIVEVRDILARFTTDVIG 187

  Fly   171 NLIYGLDINNF---EHEDHILTSYLSHSQ-------ASIQSF-TLGR-----LPQKSSYTYRLRD 219
            ...:|::.::.   |.|..::.......|       |.|.|| .|.|     :..:.:..:.|| 
  Fly   188 TCAFGIECSSLKDPEAEFRVMGRRAIFEQRHGPIGIAFINSFQNLARRLHMKITLEEAEHFFLR- 251

  Fly   220 LIKQSVELREDHGLIRKDILQLLVRFRNG---NEVSGDKWQLEPINDADKLLSIKRLAKVAEDLL 281
            :::::|..||.:.:.|.|.:..|:..:|.   ...||     |.:|     |:|:.:|..|....
  Fly   252 IVRETVAFREKNNIRRNDFMDQLIDLKNSPLTKSESG-----ESVN-----LTIEEMAAQAFVFF 306

  Fly   282 KVSLDAVASTVTFTLLEILQEPLIVEKLRAEIKE-LSNENGQLKFEELNGLRYMDMCLKETLRKY 345
            ....:..::|:.|.|.|:.|...|.:::|.|.:| :...||::.:|.:..:.|:|..:.||||.|
  Fly   307 GAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKDMVYLDQVISETLRLY 371

  Fly   346 PPLPIIERVCRKSYSLP-NSKFTIDEGKTLMVPLLAMHRDEKYFSEPMKYKPLRFLQTANDVGQC 409
            ..||::.|.|.:.|.:| :.|:.|.:|..:::|..|||||||.::.|..:.|..|         .
  Fly   372 TVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNF---------S 427

  Fly   410 EDKTK---SNVFIGFGIGGSQCVGQNFAKLVIKVALIKLLQNFHLELDANQVKTLKVSHRPAPF- 470
            .::.|   |..::.||.|...|:|..|.::..:..|..|:..|  :....:..|:.:.:....| 
  Fly   428 PERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRF--KFSVCEQTTIPIVYSKKTFL 490

  Fly   471 IHTKDGLKVKLKR 483
            |.::.|:.:|::|
  Fly   491 ISSETGIFLKVER 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp310a1NP_609891.1 p450 69..454 CDD:299894 104/423 (25%)
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 117/500 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461196
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
76.850

Return to query results.
Submit another query.