DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp310a1 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_609891.1 Gene:Cyp310a1 / 35115 FlyBaseID:FBgn0032693 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:529 Identity:116/529 - (21%)
Similarity:221/529 - (41%) Gaps:105/529 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLPILLYSAVFLS--VRHIYSHWRRRGFPSEKAGITWS---------FLQKAYRREFRHVEAIC 56
            ||:.:||.:.|.|:  :||.|.::|.||.|..... :||         ||:.::...||.:.|  
  Fly     2 LLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPS-SWSPMGNLGQLLFLRISFGDLFRQLYA-- 63

  Fly    57 EAYQSGKDRLLGIYCFFRPVLLVRNVELAQTILQQSNGHFSELKWDYISGYRRFNLLEKLAPM-- 119
             ..::|:.:::|.:.|..|.|:||:.||.:.:|.::..:|          ..||...:...||  
  Fly    64 -DPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNF----------LNRFESADAGDPMGA 117

  Fly   120 ---------------------FGTKRLSE-MFGQVQKVGDHLIHHLLDRQGQGCPQEVDIQQKLR 162
                                 |.:.|:.: |:.|:..|...|..:|..:.|....:.:.:.:..:
  Fly   118 LTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQ 182

  Fly   163 VYSVNIIANLIYGLDINNFEH-EDHILTS----YLSHSQASIQSFTLGRLPQ----------KSS 212
            :|:.::..||.|.|::..... ...::|.    :.::.:..:...::..||:          ...
  Fly   183 LYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTED 247

  Fly   213 YTYRLRDLIKQSVELREDHGLIRKDILQLLVRFRNGNEVSGDKWQLEPINDADKLLSIKRLAKVA 277
            |...:|.|:.      :.|...:.|::..|..|:...  |.:.:...|          ..:|..|
  Fly   248 YARYMRHLVD------DHHEPTKGDLINQLQHFQLSR--SSNHYSQHP----------DFVASQA 294

  Fly   278 EDLLKVSLDAVASTVTFTLLEILQEPLIVEKLRAEIKELSNENGQLKFEELNGLRYMDMCLKETL 342
            ..:|....:..::.:.|||.|:.:.|.|.|:||:|::|.......|.::.|..|.|:.|...|.|
  Fly   295 GIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEAL 359

  Fly   343 RKYPPLPIIERVCRKS----YSL-PNSKFTIDEGKTLMVPLLAMHRDEKYFSEPMKYKPLRFLQT 402
            |.||....:.|.|..|    :|| |:..|.:..|....:.:|.:||||:::.||..:.|.||   
  Fly   360 RLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERF--- 421

  Fly   403 ANDVGQCEDKTKSN-----VFIGFGIGGSQCVGQNFAKLVIKVALIKLLQNFHLELDANQVKTLK 462
                    ...:|.     .:|.||.|...|:|.....|.:|:.::.:|:.:.:|.....|..::
  Fly   422 --------GPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIR 478

  Fly   463 VSHRPAPFI 471
            .:  |..|:
  Fly   479 FN--PKSFM 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp310a1NP_609891.1 p450 69..454 CDD:299894 91/433 (21%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 103/497 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461010
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
76.850

Return to query results.
Submit another query.