DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp310a1 and Cyp309a2

DIOPT Version :9

Sequence 1:NP_609891.1 Gene:Cyp310a1 / 35115 FlyBaseID:FBgn0032693 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster


Alignment Length:514 Identity:125/514 - (24%)
Similarity:213/514 - (41%) Gaps:118/514 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLPILLYSAVFLSVRHIYSHWRRRGF----PSEKAGITWSFLQKAYRREFRHVEAICEAYQSGK 63
            |:|||.||    |:..|.|  ||:||.    |....|.....|.:.....| .|:.|.:.|: ||
  Fly    46 LVLPIYLY----LTWHHKY--WRKRGLVTARPLTLLGTYPGLLTRKSNLVF-DVQKIYDKYK-GK 102

  Fly    64 DRLLGIYCFFRPVLLVRNVELAQTILQQS---------NGHFSELKWD--------YISG--YRR 109
            .|.:|::...:|.:||.:.|||..:|..:         :.:....|||        :.||  :||
  Fly   103 HRAVGVFVTRQPQILVLDPELAHEVLVSNFRCYKDSLQSSYLRHAKWDKYARLNPFWASGQSWRR 167

  Fly   110 FNLLEKLAPMFGTKRLSEMFGQVQKVGDHLIHHLLDRQGQGCPQEVDIQQKLRV---------YS 165
            .. .:..|.:.|: ||.:.:...::.|..|..::..:          :.:|..:         |:
  Fly   168 LR-TDAQAGISGS-RLRQAYNIWEQGGQMLTEYMTQQ----------VAEKNNILETRDLCFRYT 220

  Fly   166 VNIIANLIYGLDINNFEHE-------DHILTSYLSHSQASIQSFTLGRLPQKSSYTYRLR----- 218
            .:::|:.|:|:|.......       ..:.:.:.|::...:..|....:...|....|.|     
  Fly   221 AHVMADFIWGIDAGTLTRPMEQPNKVQEMASKWTSYAFYMLTLFMATIVAPCSRLLLRFRFYPKE 285

  Fly   219 ------DLIKQSVELREDHG-LIRKDILQLLVRFRNGNEVSGDKWQLEPINDADKLLSIKRLAKV 276
                  :|.|:|:|||...| ..|.|.|..|::.|:..:.:.|                      
  Fly   286 TDEFFSNLTKESIELRLKAGDSTRTDYLSHLLQLRDQKQATHD---------------------- 328

  Fly   277 AEDL----LKVSLDAVASTVT---FTLLEILQEPLIVEKLRAEIKELSNENGQLKFEELNGLRYM 334
              ||    |.|.||...::.|   ..|..:.:.|.:.:|||.||.........|.||:|:.|:|:
  Fly   329 --DLVGHALTVMLDGYDTSGTALLHALYYLAENPAVQQKLRVEILSCMASEKSLDFEKLSSLQYL 391

  Fly   335 DMCLKETLRKYPPLPIIERVCRKSYSLP-------NSKFTIDEGKTLMVPLLAMHRDEKYFSEPM 392
            :..:.|:||....:|...:||    :||       :....::.|.|:|:|....|.|::||.||.
  Fly   392 EQVIYESLRLSSLIPQYTKVC----TLPTVIRLSESKSLDVEVGMTIMIPNYQFHHDKQYFPEPE 452

  Fly   393 KYKPLRFLQTANDVGQCEDKTKSNVFIGFGIGGSQCVGQNFAKLVIKVALIKLLQNFHL 451
            .:||.||     |.|..::..:..:|:.|..|...|:|...|.|.:|.||:.:|.||.:
  Fly   453 AFKPERF-----DNGAYQELMRKGIFLPFSDGPRICMGVPLAMLTLKSALVHILSNFQV 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp310a1NP_609891.1 p450 69..454 CDD:299894 101/444 (23%)
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 112/484 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460876
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.