DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp310a1 and Cyp28c1

DIOPT Version :9

Sequence 1:NP_609891.1 Gene:Cyp310a1 / 35115 FlyBaseID:FBgn0032693 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001259464.1 Gene:Cyp28c1 / 32138 FlyBaseID:FBgn0030339 Length:505 Species:Drosophila melanogaster


Alignment Length:538 Identity:120/538 - (22%)
Similarity:211/538 - (39%) Gaps:88/538 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLPI-LLYSAVFLSVRHIYSHWRRRGFPSEKA--------GITWSFLQKAYRREFRHVEAICEA 58
            |||.| .|..|::..:...:.||||||....:|        .:.|.  ::.:..:.|.:    ..
  Fly     5 LLLGIATLLGAIYAFLVSNFGHWRRRGVTEPRALPLFGSFPNMIWP--RQHFTMDMRDI----YM 63

  Fly    59 YQSGKDRLLGIYCFFRPVLLVRNVELAQTILQQSNGHFS--------ELKWDYISGYRRFNLLE- 114
            :.......:|.|....|.|||....|...|...:..||.        ::..|.:.....| :|| 
  Fly    64 HYRNTHSYVGCYLLRAPKLLVLEPRLVYEIYVSAFSHFENNDASKMVDIAKDRLVALNPF-VLEG 127

  Fly   115 --------KLAPMFGTKRLSEMFGQVQKVGDHLIHHLLDRQGQGCPQEVD-IQQKLRVYSVNIIA 170
                    ..:.:....|:......:|:|...|...:..:...|  :::| |...|| ::...:.
  Fly   128 EEWRHQRAVFSTLLTNGRIRTTHAIMQRVCLDLCQFIAIKSAGG--KDLDCIDLGLR-FTGESLF 189

  Fly   171 NLIYGLDINNFEHEDHILTSYLSHSQASIQSFTLG----------RLPQ-------KSSYTYRLR 218
            :.:.|:....|  .|:.|.....:.:.|.::..|.          .||:       ..|:.....
  Fly   190 DCVLGIQARTF--TDNPLPVVRQNHEMSAENRGLAIAGAVHGLFPNLPRWLRPKVFPRSHDRFYG 252

  Fly   219 DLIKQSVELREDHGLIRKDILQLLVRFRNGNEVSGDKWQLEPINDADKLLSIKRLAKVAEDLLKV 283
            .:|.:::.||......|.|.:..|               ||...:.|  ||.:.:|..|...:..
  Fly   253 QMISEALRLRRSKHQERNDFINHL---------------LEMQRELD--LSEEDMASHAMTFMFD 300

  Fly   284 SLDAVASTVTFTLLEILQEPLIVEKLRAEIKELSNENGQL-KFEELNGLRYMDMCLKETLRKYPP 347
            .||..::::...||.:.:.|....:|..|: :|.|..|.| ..:.|..|.|:..|..|:||.||.
  Fly   301 GLDTTSNSIAHCLLLLGRNPDCQRRLYEEL-QLVNPGGYLPDLDALIDLPYLSACFNESLRIYPA 364

  Fly   348 LPIIERVCRKSYSLPNSKFT----IDEGKTLMVPLLAMHRDEKYFSEPMKYKPLRFLQTANDVGQ 408
            .....:.|.|.|.|..|..:    :..|..:|||:.|:|.|...:.||..::|.|||.     |.
  Fly   365 GGWASKTCTKEYELRGSHHSEPLKLRPGDHVMVPIYALHNDPDLYPEPDVFRPERFLD-----GG 424

  Fly   409 CEDKTKSNVFIGFGIGGSQCVGQNFAKLVIKVALIKLLQNFHLELDANQVKTLKVSHRPAPFIHT 473
            .::..:..:|:|||.|..||||......:.|.||..::|.|.:.:....:...::.  |..|:..
  Fly   425 LKNCKQQGIFLGFGNGPRQCVGMRLGLAMAKAALAAIVQRFEVVVSPRTLNGTELD--PLIFVGV 487

  Fly   474 -KDGLKVK-LKRREINTK 489
             |.|:.:: :.|:.:.||
  Fly   488 HKGGIWLQFVPRKNVTTK 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp310a1NP_609891.1 p450 69..454 CDD:299894 97/424 (23%)
Cyp28c1NP_001259464.1 p450 35..487 CDD:299894 103/488 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460852
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.