DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp310a1 and Tbxas1

DIOPT Version :9

Sequence 1:NP_609891.1 Gene:Cyp310a1 / 35115 FlyBaseID:FBgn0032693 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_035669.3 Gene:Tbxas1 / 21391 MGIID:98497 Length:533 Species:Mus musculus


Alignment Length:487 Identity:96/487 - (19%)
Similarity:196/487 - (40%) Gaps:98/487 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LLGIYCFFRPVLLVRNVELAQTILQQSNGHFS--------------------ELKWDYISGYRRF 110
            |.|.|...|..:::...::.:.:|.::..:||                    :.:|:.:.|    
Mouse    77 LCGYYLGRRMHVVISEPDMIKQVLVENFSNFSNRMASGLEPKMVADSVLLLRDRRWEEVRG---- 137

  Fly   111 NLLEKLAPMFGTKRLSEMFGQVQKVGDHLIHHLLDRQGQGCPQEVDIQQKLRVYSVNIIANLIYG 175
                .|...|..::|.||...:.:..:.|:.||  ::........:||:....|:::::|::.:|
Mouse   138 ----ALMSSFSPEKLDEMTPLISQACELLVAHL--KRYAASRDAFNIQRCYCCYTIDVVASVAFG 196

  Fly   176 LDINNFEH-EDHILTSYLSHSQAS------------IQSF-----TLGR-LPQKSSYTYRLRD-- 219
            ..:::... ||    .::.|.:.:            |.||     .|.| ||.|:      ||  
Mouse   197 TQVDSQNSPED----PFVQHCRRASTFCIPRPLLVLILSFPSIMVPLARILPNKN------RDEL 251

  Fly   220 ------LIKQSVELREDHGL--IRKDILQLLVRFRNG-NEVSGDKWQLEPIN------------- 262
                  ||:..:.||:....  .|:|.||:::..::. |.|..:.:.:.|.:             
Mouse   252 NGFFNTLIRNVIALRDQQAAEERRRDFLQMVLDAQHSMNSVGVEGFDMVPESLSSSECTKEPPQR 316

  Fly   263 ----DADKLLSIKRLAKVAEDLLKVSLDAVASTVTFTLLEILQEPLIVEKLRAEIKELSNENGQL 323
                ...|..::..:...|...|....:.:.:|::|....:...|...|:|..|:.....::...
Mouse   317 CHPTSTSKPFTVDEIVGQAFLFLIAGHEVITNTLSFITYLLATHPDCQERLLKEVDLFMGKHPAP 381

  Fly   324 KFEEL-NGLRYMDMCLKETLRKYPPLPIIERVCRKSYSLPNSKFTIDEGKTLMVPLLAMHRDEKY 387
            ::..| .||.|:||.:.||||.|||.....|...:...:...:  |..|..|.:.:.|:|.|.::
Mouse   382 EYHSLQEGLPYLDMVISETLRMYPPAFRFTREAAQDCEVLGQR--IPAGTVLEIAVGALHHDPEH 444

  Fly   388 FSEPMKYKPLRFLQTANDVGQCEDKTKSNVFIGFGIGGSQCVGQNFAKLVIKVALIKLLQNFHLE 452
            :..|..:.|.||      ..:...:.:...::.||.|...|:|.....||:|:.::::|..|..|
Mouse   445 WPNPETFDPERF------TAEARLQRRPFTYLPFGAGPRSCLGVRLGLLVVKLTILQVLHKFRFE 503

  Fly   453 LDANQVKTLKVSHRPAPFIHTKDGLKVKLKRR 484
            ........|::..:.|  :..|:|:.:|:..|
Mouse   504 ASPETQVPLQLESKSA--LGPKNGVYIKIVSR 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp310a1NP_609891.1 p450 69..454 CDD:299894 88/452 (19%)
Tbxas1NP_035669.3 p450 47..528 CDD:365848 94/480 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.