DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp310a1 and cyp-25A6

DIOPT Version :9

Sequence 1:NP_609891.1 Gene:Cyp310a1 / 35115 FlyBaseID:FBgn0032693 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001360017.1 Gene:cyp-25A6 / 187059 WormBaseID:WBGene00019438 Length:235 Species:Caenorhabditis elegans


Alignment Length:127 Identity:24/127 - (18%)
Similarity:54/127 - (42%) Gaps:22/127 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EAICEAYQSGKDRLLGIYCFFRPVLLVRNVELAQTILQQSNGHFSELKWDYISGYRRFNLLEKLA 117
            |...:.:.:..||        .|..::.:.:|.:::||.:          |.||::  :....:|
 Worm    98 EVFIKNFSNFSDR--------TPPPIIEDNKLKESLLQNT----------YESGWK--HTRSAIA 142

  Fly   118 PMFGTKRLSEMFGQVQKVGDHLIHHLLDRQGQGCPQEVDIQQKLRVYSVNIIANLIYGLDIN 179
            |:|.|.::..|...:....|..:..|.::...|  |:.||....:..::::|....:.:|.|
 Worm   143 PIFSTGKMKAMHETIHSKVDLFLEILKEKASSG--QKWDIYDDFQGLTLDVIGKCAFAIDSN 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp310a1NP_609891.1 p450 69..454 CDD:299894 21/111 (19%)
cyp-25A6NP_001360017.1 p450 37..>215 CDD:386267 24/127 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.