DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp310a1 and Cyp3a9

DIOPT Version :9

Sequence 1:NP_609891.1 Gene:Cyp310a1 / 35115 FlyBaseID:FBgn0032693 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_671739.2 Gene:Cyp3a9 / 171352 RGDID:708392 Length:503 Species:Rattus norvegicus


Alignment Length:527 Identity:134/527 - (25%)
Similarity:231/527 - (43%) Gaps:107/527 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WLLLPILLYSAVFLSVRHIYSH--WRRRGFPSEKAGITWSFLQK--AYRREFRHVEAICEAYQSG 62
            ||||.|   |.|.|.:...:||  :::.|.|..|   ...||..  |||:.|...:..|.. :.|
  Rat    12 WLLLVI---SLVLLYLYGTHSHGIFKKLGIPGPK---PLPFLGTILAYRKGFWEFDKYCHK-KYG 69

  Fly    63 KDRLLGIYCFFRPVLLVRNVELAQTIL----------QQSNGHFSELK----------WDYISGY 107
            |  |.|:|...:|||.:.:.::.:|:|          :::.|....||          |      
  Rat    70 K--LWGLYDGRQPVLAITDPDIIKTVLVKECYSTFTNRRNFGPVGILKKAISISEDEEW------ 126

  Fly   108 RRFNLLEKLAPMFGTKRLSEMFGQVQKVGDHLIHHLLDRQGQGCPQEVDIQQKLRVYSVNIIANL 172
            :|...|  |:|.|.:.:|.|||..:.:..|.|:.::  |||....:...::.....||:::|...
  Rat   127 KRIRAL--LSPTFTSGKLKEMFPIINQYTDMLVRNM--RQGSEEGKPTSMKDIFGAYSMDVITAT 187

  Fly   173 IYGLDI---NN--------------FEHEDHILTS-----YLSHSQASIQSFTLGRLPQKSSYTY 215
            .:|:::   ||              |:..|.:..|     :|:   ...::..:...|:.     
  Rat   188 SFGVNVDSLNNPQDPFVEKIKKLLKFDIFDPLFLSVTLFPFLT---PLFEALNVSMFPRD----- 244

  Fly   216 RLRDLIKQSVELREDHGLIRK-----DILQLLVRFRNGNEVSGDKWQLEPINDADKLLSIKRLAK 275
             :.|..|.|||..:::.:..|     |.|||::..:|..           :.|:.|.||...:..
  Rat   245 -VIDFFKTSVERMKENRMKEKEKQRMDFLQLMINSQNSK-----------VKDSHKALSDVEIVA 297

  Fly   276 VAEDLLKVSLDAVASTVTFTLLEILQEPLIVEKLRAEIKELSNENGQLKFEELNGLRYMDMCLKE 340
            .:...:....:..:|.::|.|..:...|.|.:||:.||...........::.|..:.|:||.:.|
  Rat   298 QSVIFIFAGYETTSSALSFVLYLLAIHPDIQKKLQDEIDAALPNKAHATYDTLLQMEYLDMVVNE 362

  Fly   341 TLRKYPPLPIIERVCRKSYSLPNSKFTIDEGKTLMVPLLAMHRDEKYFSEPMKYKPLRFLQTAND 405
            |||.||....:||||:....: |..| |.:|..:|:|..|:|:|..|:.||.:::|.||.:    
  Rat   363 TLRLYPIAGRLERVCKTDVEI-NGVF-IPKGTVVMIPTFALHKDPHYWPEPEEFRPERFSK---- 421

  Fly   406 VGQCEDKTKSNVFIGFGIGGSQCVGQNFAKLVIKVALIKLLQNFHLELDANQVKTLKVSHRPAPF 470
              :.:|.....:::.||.|...|:|..||.:.:||||:::||||..:........||:|      
  Rat   422 --KNQDNINPYMYLPFGNGPRNCIGMRFALMNMKVALVRVLQNFSFQPCKETQIPLKLS------ 478

  Fly   471 IHTKDGL 477
               |.||
  Rat   479 ---KQGL 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp310a1NP_609891.1 p450 69..454 CDD:299894 104/431 (24%)
Cyp3a9NP_671739.2 p450 39..493 CDD:278495 123/497 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.