DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp310a1 and Cyp3a62

DIOPT Version :9

Sequence 1:NP_609891.1 Gene:Cyp310a1 / 35115 FlyBaseID:FBgn0032693 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001019403.1 Gene:Cyp3a62 / 170509 RGDID:1595919 Length:497 Species:Rattus norvegicus


Alignment Length:510 Identity:121/510 - (23%)
Similarity:223/510 - (43%) Gaps:112/510 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WLLLPILLYSAVFLSVRHIYSHWRRRGFPSEKAGIT----WSFLQK--AYRREFRHVEAICEAYQ 60
            |:||      |..|.:.::|.......|  :|.||:    ..|:..  |||..|...:..|....
  Rat    12 WMLL------ATILVLLYLYGTSTHGNF--KKLGISGPKPLPFVGNILAYRHGFWEFDRHCHKKY 68

  Fly    61 SGKDRLLGIYCFFRPVLLVRNVELAQTIL----------QQSNGHFSELK----------WDYIS 105
            ..   :.|.|...:|:|.:.:.::.:|:|          ::|.|....||          |    
  Rat    69 GD---IWGFYEGRQPILAITDPDIIKTVLVKECYSTFTNRRSFGPAGILKKAITLSEDEEW---- 126

  Fly   106 GYRRFNLLEKLAPMFGTKRLSEMFGQVQKVGDHLIHHLLDRQGQGCPQEVDIQQKLRVYSVNIIA 170
              :|...|  |:|.|.:.:|.|||..:.:..|.|:.::.....:|.|  :.::.....||:::|.
  Rat   127 --KRLRTL--LSPTFTSGKLKEMFPIINQYADLLVKNVKHEAEKGNP--ITMKDIFGAYSMDVIT 185

  Fly   171 NLIYGLDINNFEHEDH----------------------ILTSYLSHSQASIQSFTLGRLPQKSSY 213
            ...:|:::::..:..:                      ||..:|:   ...::|.:...|     
  Rat   186 GTSFGVNVDSLNNPQNPFVQKVKKLLKFNFLDPFFLSVILFPFLT---PVFEAFDITVFP----- 242

  Fly   214 TYRLRDLIK---QSVELREDHGLIRK-----DILQLLVRFRNGNEVSGDKWQLEPINDADKLLSI 270
                :|::|   .|||..:::.:..|     |.|||::    .::.||||...:.:.|.:     
  Rat   243 ----KDVMKFFRTSVERMKENRMQEKVKQRLDFLQLMI----NSQSSGDKESHQGLTDVE----- 294

  Fly   271 KRLAKVAEDLLKV--SLDAVASTVTFTLLEILQEPLIVEKLRAEIKELSNENGQLKFEELNGLRY 333
                .||:.:..:  ..:..:|.::|.|..:...|.:.:||:.||.........:.::.|..:.|
  Rat   295 ----IVAQSIFFIFAGYETTSSALSFALYLLATHPDLQKKLQDEIDAALPNKAPVTYDVLVEMEY 355

  Fly   334 MDMCLKETLRKYPPLPIIERVCRKSYSLPNSKFTIDEGKTLMVPLLAMHRDEKYFSEPMKYKPLR 398
            :||.|.||||.:|....:||||:|...: |..| |.:|..:|||..|:|:|.|.:.||.::.|.|
  Rat   356 LDMVLNETLRLFPVGGRLERVCKKDVEI-NGVF-IPKGTVVMVPTFALHKDPKCWPEPEEFCPER 418

  Fly   399 FLQTANDVGQCEDKTKSNVFIGFGIGGSQCVGQNFAKLVIKVALIKLLQNFHLEL 453
            |.:      :.:|.....:::.||.|...|:|..||.:.:|:||:::||||...|
  Rat   419 FRK------KNQDSINPYIYLPFGNGPRNCIGMRFALMNMKIALVRVLQNFSFGL 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp310a1NP_609891.1 p450 69..454 CDD:299894 104/437 (24%)
Cyp3a62NP_001019403.1 p450 39..491 CDD:278495 111/475 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.