DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IFT46 and IFT46

DIOPT Version :9

Sequence 1:NP_609890.2 Gene:IFT46 / 35114 FlyBaseID:FBgn0032692 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_064538.3 Gene:IFT46 / 56912 HGNCID:26146 Length:355 Species:Homo sapiens


Alignment Length:354 Identity:98/354 - (27%)
Similarity:145/354 - (40%) Gaps:118/354 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RRMFQNNSTDDDGLLQDIIDHDDEAE-DSEDDDDSEMQLPQGMTMGVGMTGLVPGPNMQKRPGSN 123
            :|.|..|..|||       |.||.:| ||:.|||.|                             
Human    77 QRGFSENEDDDD-------DDDDSSETDSDSDDDDE----------------------------- 105

  Fly   124 RSSKQVPDDTLSSGSEEAAMGGRMGSGGARGGAKLPHQKLTLPMRGSASGAGRSKRQDDQSFIMS 188
                           |..|                       |:.|:...|              
Human   106 ---------------EHGA-----------------------PLEGAYDPA-------------- 118

  Fly   189 ADKWEDLSVPGELKELFPYIVKYTPQTIDTPFHLQPFIPEFVPAVGDVDALLKVQAPPLLQPQRQ 253
              .:|.|.|..|:||||.||.:||||.||....|:||||:|:|||||:||.|||..|        
Human   119 --DYEHLPVSAEIKELFQYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRP-------- 173

  Fly   254 KDLNDHLEKLGLWLLDEPSGAQSEPSLLNMKLRSVLSGSMGRN-PRHASSASLVPTARSGKDIEK 317
               :...:.|||.:|||||..||:|::|::.|   ...|...| .:|....||....::.|.|:.
Human   174 ---DGKPDNLGLLVLDEPSTKQSDPTVLSLWL---TENSKQHNITQHMKVKSLEDAEKNPKAIDT 232

  Fly   318 WITEVEQVHMTQ---SMYDVQPRKDIDALLEDWPRSFGDEQTINALDQAYRSCLQQNISVAEYVG 379
            ||..:.::|.::   :::..:|..|||.|:::|...|.:.....:|..|...|     |:|||:.
Human   233 WIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEFEELLGKVSLPTAEIDC-----SLAEYID 292

  Fly   380 VLCERFGVEGPLESQADYIHNVQTLFALY 408
            ::|....:  |:....  |.::..||:||
Human   293 MICAILDI--PVYKSR--IQSLHLLFSLY 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IFT46NP_609890.2 IFT46_B_C 189..409 CDD:289115 77/224 (34%)
IFT46NP_064538.3 IFT46_B_C 116..318 CDD:289115 54/202 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141894
Domainoid 1 1.000 119 1.000 Domainoid score I5816
eggNOG 1 0.900 - - E1_2CDGQ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4422
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006643
OrthoInspector 1 1.000 - - oto91376
orthoMCL 1 0.900 - - OOG6_104593
Panther 1 1.100 - - LDO PTHR13376
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3191
SonicParanoid 1 1.000 - - X4873
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.