DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IFT46 and Ift46

DIOPT Version :9

Sequence 1:NP_609890.2 Gene:IFT46 / 35114 FlyBaseID:FBgn0032692 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001019931.1 Gene:Ift46 / 300675 RGDID:1307682 Length:301 Species:Rattus norvegicus


Alignment Length:354 Identity:98/354 - (27%)
Similarity:144/354 - (40%) Gaps:126/354 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 FQNNSTDDDGLLQDIIDHDDEAE-DSEDDDDSEMQLPQGMTMGVGMTGLVPGPNMQKRPGSNRSS 126
            |..|..|||         ||.:| ||:||||.|                                
  Rat    28 FSENDDDDD---------DDSSETDSDDDDDDE-------------------------------- 51

  Fly   127 KQVPDDTLSSGSEEAAMGGRMGSGGARGGAKLPHQKLTLPMRGSASGAGRSKRQDDQSFIMSADK 191
                        |..|                       |:.|:...|                .
  Rat    52 ------------EHGA-----------------------PLEGAYDPA----------------D 65

  Fly   192 WEDLSVPGELKELFPYIVKYTPQTIDTPFHLQPFIPEFVPAVGDVDALLKVQAP---PLLQPQRQ 253
            :|.|.|..|:||||.||.:||||.||....|:||||:|:|||||:||.|||..|   |       
  Rat    66 YEHLPVSAEIKELFEYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKP------- 123

  Fly   254 KDLNDHLEKLGLWLLDEPSGAQSEPSLLNMKLRSVLSGSMGRN-PRHASSASLVPTARSGKDIEK 317
                ||   |||.:|||||..||:|::|::.|   ...|...| .:|....||....::.|.|:.
  Rat   124 ----DH---LGLLVLDEPSTKQSDPTVLSLWL---TENSKQHNITQHMKVKSLEDAEKNPKAIDT 178

  Fly   318 WITEVEQVHMTQ---SMYDVQPRKDIDALLEDWPRSFGDEQTINALDQAYRSCLQQNISVAEYVG 379
            ||..:.::|.::   :::..:|..|||.|:::|...|.:     .|.:.....::.:.|:|||:.
  Rat   179 WIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEFEE-----LLGKVSLPTVEIDCSLAEYID 238

  Fly   380 VLCERFGVEGPLESQADYIHNVQTLFALY 408
            ::|....:  |.....  |.::..||:||
  Rat   239 MICAILDI--PFYKSR--IQSLHLLFSLY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IFT46NP_609890.2 IFT46_B_C 189..409 CDD:289115 78/227 (34%)
Ift46NP_001019931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..66 20/129 (16%)
IFT46_B_C 62..264 CDD:403511 79/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335614
Domainoid 1 1.000 118 1.000 Domainoid score I5720
eggNOG 1 0.900 - - E1_2CDGQ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4704
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006643
OrthoInspector 1 1.000 - - oto98458
orthoMCL 1 0.900 - - OOG6_104593
Panther 1 1.100 - - LDO PTHR13376
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4873
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.750

Return to query results.
Submit another query.