Sequence 1: | NP_609889.1 | Gene: | Atac2 / 35113 | FlyBaseID: | FBgn0032691 | Length: | 774 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_444326.2 | Gene: | Nat8f2 / 93673 | MGIID: | 2136446 | Length: | 238 | Species: | Mus musculus |
Alignment Length: | 229 | Identity: | 39/229 - (17%) |
---|---|---|---|
Similarity: | 72/229 - (31%) | Gaps: | 92/229 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 571 SSFHARLAGCTQYELFESPYSQRVLHPFIFRSETMAPPWLKLMCELQHRVNGSHPTRSTIDFCFV 635
Fly 636 RPQHIPAVNALLQSTFWPNIDVSECLSYPDYSVVALYKKLVIGCGFLV----------------- 683
Fly 684 ----------------------------------PDVGYNEAYISFMAVRPCWQRSGIASFMLYH 714
Fly 715 LIQTCMSK---DITLHV-SATNAAVMLYQKFGFK 744 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Atac2 | NP_609889.1 | PHD | 14..63 | CDD:214584 | |
rimI | 639..753 | CDD:273701 | 26/161 (16%) | ||
Acetyltransf_1 | 676..744 | CDD:278980 | 17/122 (14%) | ||
Nat8f2 | NP_444326.2 | RimI | <88..197 | CDD:223532 | 16/106 (15%) |
Acetyltransf_1 | 112..193 | CDD:278980 | 15/80 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0456 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |