DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac2 and NAT8

DIOPT Version :9

Sequence 1:NP_609889.1 Gene:Atac2 / 35113 FlyBaseID:FBgn0032691 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_003951.3 Gene:NAT8 / 9027 HGNCID:18069 Length:227 Species:Homo sapiens


Alignment Length:123 Identity:29/123 - (23%)
Similarity:51/123 - (41%) Gaps:19/123 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   641 PAVNALLQSTFWPNIDVSECLSYPDYSV-----------VALYKKLVIG-CGFL-VPDVGYNEAY 692
            ||:..|.:..:...:|::.|....|.:.           ||..::.|:| .|.| |.|....|..
Human    72 PALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKR 136

  Fly   693 ISF--MAVRPCWQRSGIASFMLYHLIQTCMSKDITLHVSATN----AAVMLYQKFGFK 744
            :..  :.|....:|.|||..::..::|....:..:..:..|.    :|:.|||..|||
Human   137 LQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac2NP_609889.1 PHD 14..63 CDD:214584
rimI 639..753 CDD:273701 29/123 (24%)
Acetyltransf_1 676..744 CDD:278980 19/75 (25%)
NAT8NP_003951.3 RimI <101..200 CDD:223532 23/94 (24%)
Acetyltransf_1 113..194 CDD:278980 19/80 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.