DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Atac2 and NAA60

DIOPT Version :9

Sequence 1:	NP_609889.1	Gene:	Atac2 / 35113	FlyBaseID:	FBgn0032691	Length:	774	Species:	Drosophila melanogaster
Sequence 2:	NP_001304022.1	Gene:	NAA60 / 79903	HGNCID:	25875	Length:	249	Species:	Homo sapiens

Alignment Length:	130	Identity:	31/130 - (23%)
Similarity:	48/130 - (36%)	Gaps:	41/130 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly   663 YPD------------YSVVALYKKLVIGCGFLVPD--------------------VGYNEAYISF 695
            |||            :|:.|.|:..::  |.:|.:                    |....|||..
Human    45 YPDSWYRDITSNKKFFSLAATYRGAIV--GMIVAEIKNRTKIHKEDGDILASNFSVDTQVAYILS 107

  Fly   696 MAVRPCWQRSGIASFMLY----HLIQTCMS--KDITLHVSAT-NAAVMLYQKFGFKMEEIILDFY 753
            :.|...:::.||.|.:|.    |:..|...  |.|.|||..| |.|:..|:...||....:..:|
Human   108 LGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYYY 172

Fly 754 753
Human 173 172

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Atac2	NP_609889.1	PHD	14..63	CDD:214584
		rimI	639..753	CDD:273701	30/128 (23%)
		Acetyltransf_1	676..744	CDD:278980	22/94 (23%)
NAA60	NP_001304022.1	RimI	<44..173	CDD:223532	31/130 (24%)
NAA60	NP_001304022.1	Acetyltransf_1	86..163	CDD:278980	20/76 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0456
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810