DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac2 and Nat8f1

DIOPT Version :9

Sequence 1:NP_609889.1 Gene:Atac2 / 35113 FlyBaseID:FBgn0032691 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_006506533.1 Gene:Nat8f1 / 66116 MGIID:1913366 Length:232 Species:Mus musculus


Alignment Length:251 Identity:54/251 - (21%)
Similarity:82/251 - (32%) Gaps:81/251 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 IPAYVRRLYRKLSLRKWKRDHNR-----------HIFNLDEHIDPLGRARLKMLGHQKAEILDR- 558
            :|.::|: |:       ..||.|           :|.:...|:..|.|..|.:||...|.:|.. 
Mouse    12 VPYHIRQ-YQ-------DSDHKRVVDVFTKGMEEYIPSTFRHMLMLPRTLLLLLGVPLALVLVSG 68

  Fly   559 ---------YQLLAHSRQDARSSFHARLAGCTQYELFESPYSQRVLHPFIF-------------- 600
                     :.||...|..||..:...:|.|.|.::.:...|...:|...|              
Mouse    69 SWILAVICIFFLLLLLRLLARQPWKEYVAKCLQTDMVDITKSYLNVHGACFWVAESGGQVVGIVA 133

  Fly   601 RSETMAPP-------WLKLMCELQHRVNG--SHPTRSTIDFCFVRPQHIPAVNALLQSTFWPNID 656
            ......||       ..:|....|||..|  ...||:.:.  |.|.|                  
Mouse   134 AQPVKDPPLGRKQLQLFRLSVSSQHRGQGIAKALTRTVLQ--FARDQ------------------ 178

  Fly   657 VSECLSYPDYSVVALYKKLVIGCGFLVPDVGYNEAYISFMAVRPCWQRSGIASFML 712
                 ||.|  ||.....|..|...|...:|:.:|...||::  .|:.:||.:..|
Mouse   179 -----SYSD--VVLETSALQQGAVTLYLGMGFKKAGQYFMSI--FWRLAGICTIQL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac2NP_609889.1 PHD 14..63 CDD:214584
rimI 639..753 CDD:273701 16/74 (22%)
Acetyltransf_1 676..744 CDD:278980 10/37 (27%)
Nat8f1XP_006506533.1 Acetyltransf_1 101..203 CDD:366181 24/128 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.