DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac2 and naa60

DIOPT Version :10

Sequence 1:NP_609889.1 Gene:Atac2 / 35113 FlyBaseID:FBgn0032691 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001076341.1 Gene:naa60 / 570640 ZFINID:ZDB-GENE-041111-143 Length:242 Species:Danio rerio


Alignment Length:132 Identity:30/132 - (22%)
Similarity:49/132 - (37%) Gaps:41/132 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   661 LSYPD------------YSVVALYKKLVIGCGFLVPD--------------------VGYNEAYI 693
            :.|||            :|:.|.::..::  |.:|.:                    |....|||
Zfish    36 IEYPDSWYHDITSNKKFFSLAATFRGGIV--GMIVAEIKSRTKVHKEDGDILASSFPVDTQVAYI 98

  Fly   694 SFMAVRPCWQRSGIASFML----YHLIQTCMS--KDITLHVSAT-NAAVMLYQKFGFKMEEIILD 751
            ..:.|...:::.||.|.:|    .|:..|...  |.|.|||..| |.|:..|:...||....:..
Zfish    99 LSLGVVKEFRKHGIGSLLLDSLKEHISTTAQDHCKAIYLHVLTTNNTAIHFYENRDFKQHHYLPY 163

  Fly   752 FY 753
            :|
Zfish   164 YY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac2NP_609889.1 PHD 14..63 CDD:214584
RimI 678..753 CDD:440224 24/101 (24%)
naa60NP_001076341.1 yhbS 15..156 CDD:442387 27/121 (22%)
RimI 88..171 CDD:440224 23/78 (29%)
Required for homodimerization. /evidence=ECO:0000250|UniProtKB:Q9H7X0 162..173 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.