DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Atac2 and nat15

DIOPT Version :9

Sequence 1:	NP_609889.1	Gene:	Atac2 / 35113	FlyBaseID:	FBgn0032691	Length:	774	Species:	Drosophila melanogaster
Sequence 2:	NP_001076341.1	Gene:	nat15 / 570640	ZFINID:	ZDB-GENE-041111-143	Length:	242	Species:	Danio rerio

Alignment Length:	132	Identity:	30/132 - (22%)
Similarity:	49/132 - (37%)	Gaps:	41/132 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly   661 LSYPD------------YSVVALYKKLVIGCGFLVPD--------------------VGYNEAYI 693
            :.|||            :|:.|.::..::  |.:|.:                    |....|||
Zfish    36 IEYPDSWYHDITSNKKFFSLAATFRGGIV--GMIVAEIKSRTKVHKEDGDILASSFPVDTQVAYI 98

  Fly   694 SFMAVRPCWQRSGIASFML----YHLIQTCMS--KDITLHVSAT-NAAVMLYQKFGFKMEEIILD 751
            ..:.|...:::.||.|.:|    .|:..|...  |.|.|||..| |.|:..|:...||....:..
Zfish    99 LSLGVVKEFRKHGIGSLLLDSLKEHISTTAQDHCKAIYLHVLTTNNTAIHFYENRDFKQHHYLPY 163

  Fly   752 FY 753
            :|
Zfish   164 YY 165

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Atac2	NP_609889.1	PHD	14..63	CDD:214584
		rimI	639..753	CDD:273701	29/130 (22%)
		Acetyltransf_1	676..744	CDD:278980	22/94 (23%)
nat15	NP_001076341.1	RimI	20..166	CDD:223532	30/132 (23%)
		Acetyltransf_1	79..156	CDD:278980	20/76 (26%)
		Acetyl-CoA binding. /evidence=ECO:0000250\|UniProtKB:Q9H7X0	101..103		0/1 (0%)
		Acetyl-CoA binding. /evidence=ECO:0000250\|UniProtKB:Q9H7X0	109..114		2/4 (50%)
		Acetyl-CoA binding. /evidence=ECO:0000250\|UniProtKB:Q9H7X0	150..153		1/2 (50%)
		Required for homodimerization. /evidence=ECO:0000250\|UniProtKB:Q9H7X0	162..173		1/4 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0456
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.810