DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac2 and Naa60

DIOPT Version :9

Sequence 1:NP_609889.1 Gene:Atac2 / 35113 FlyBaseID:FBgn0032691 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_008765741.1 Gene:Naa60 / 363545 RGDID:1308915 Length:295 Species:Rattus norvegicus


Alignment Length:300 Identity:63/300 - (21%)
Similarity:100/300 - (33%) Gaps:104/300 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 IPSENLKLINAYEEQKLYQRL---DRIFALEHQCHISIP-AYVRRLYRKLSLRKWKRDHNRHIFN 532
            :||..|..::.        ||   |.|..::|.|....| .|....||.::       .|:..|:
  Rat     5 VPSSALSEVSL--------RLLCHDDIDTVKHLCGDWFPIEYPDSWYRDIT-------SNKKFFS 54

  Fly   533 LDEHIDPLGRARLKMLGHQKAEILDRYQLLAHSRQDARSSFHARLAGCTQYELFESPYSQRVLHP 597
            |      ....|..::|...|||.:|.::  |.    .:..|..|||                  
  Rat    55 L------AATYRGAIVGMIVAEIKNRTKI--HK----ETGIHCVLAG------------------ 89

  Fly   598 FIFRSETMAPPWLKL----MCELQHRVNGSHPTRSTIDFCFVRPQHIPAVNALLQSTFWPNIDVS 658
                        |||    :|.....|....|.|..::..                    :::|.
  Rat    90 ------------LKLRPACLCLSSAGVQDRAPMRGLLEVV--------------------SLEVK 122

  Fly   659 ECLSYPDYSVVALYKKLVIGCGFLVP---DVGYNEAYISFMAVRPCWQRSGIASFMLY----HLI 716
            |         |:|.::||...|.::.   .|....|||..:.|...:::.||.|.:|.    |:.
  Rat   123 E---------VSLKQQLVGRDGDILASSFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHIS 178

  Fly   717 QTCMS--KDITLHVSAT-NAAVMLYQKFGFKMEEIILDFY 753
            .|...  |.|.|||..| |.|:..|:...|:....:..:|
  Rat   179 TTAQDHCKAIYLHVLTTNNTAINFYENRDFRQHHYLPYYY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac2NP_609889.1 PHD 14..63 CDD:214584
rimI 639..753 CDD:273701 28/123 (23%)
Acetyltransf_1 676..744 CDD:278980 22/77 (29%)
Naa60XP_008765741.1 Acetyltransf_1 <137..208 CDD:395465 20/70 (29%)
TIM <192..>256 CDD:419668 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.