DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac2 and F30F8.10

DIOPT Version :9

Sequence 1:NP_609889.1 Gene:Atac2 / 35113 FlyBaseID:FBgn0032691 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001382268.1 Gene:F30F8.10 / 3565178 WormBaseID:WBGene00009277 Length:245 Species:Caenorhabditis elegans


Alignment Length:147 Identity:35/147 - (23%)
Similarity:60/147 - (40%) Gaps:40/147 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   642 AVNALLQSTFWPNIDVSECLSYPD----------------------YSVVALYKKLVIGCGF--- 681
            ||.||...:| |       :.|||                      .::|....|.:..|..   
 Worm    58 AVEALCNESF-P-------IQYPDCWYDEVVSGGLLSTGLFDGEQLAAMVVSETKFLYDCNLEDQ 114

  Fly   682 -LVPDVGYNEAYISFMAVRPCWQRSGIASFMLYHLIQTCMS-----KDITLHVSATN-AAVMLYQ 739
             ::|....:.|||..:||...::|.|:|:.:|.:|:.:...     :.:.|||.:|| ||:..|:
 Worm   115 GILPSSNAHVAYILSIAVDKKFRRLGLATRLLNNLMSSLSDHPPYPRAVFLHVLSTNSAALSFYK 179

  Fly   740 KFGFKMEEIILDFYDKY 756
            ..||:....:..|.:.|
 Worm   180 MHGFEFHASLPYFREYY 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac2NP_609889.1 PHD 14..63 CDD:214584
rimI 639..753 CDD:273701 33/142 (23%)
Acetyltransf_1 676..744 CDD:278980 21/77 (27%)
F30F8.10NP_001382268.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.