Sequence 1: | NP_609889.1 | Gene: | Atac2 / 35113 | FlyBaseID: | FBgn0032691 | Length: | 774 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_848652.2 | Gene: | NAT8L / 339983 | HGNCID: | 26742 | Length: | 302 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 44/205 - (21%) |
---|---|---|---|
Similarity: | 72/205 - (35%) | Gaps: | 63/205 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 550 HQKAEILDRYQLLAH-----SRQDARSSF-HARLAGCTQYELFESPYSQRVLHPFIFRSETMAPP 608
Fly 609 WLKLMCELQHRVNGSHPTRSTIDFCFVRPQHIPAVNALLQSTFWPNIDVSECLSYPDYSVVALYK 673
Fly 674 KLVIGCGFLVPDVGYNEAYISFMAVRPCWQRSGIASFMLYHLIQTCMSKDITLHVSATN----AA 734
Fly 735 VMLYQKFGFK 744 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Atac2 | NP_609889.1 | PHD | 14..63 | CDD:214584 | |
rimI | 639..753 | CDD:273701 | 22/110 (20%) | ||
Acetyltransf_1 | 676..744 | CDD:278980 | 15/71 (21%) | ||
NAT8L | NP_848652.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 46..72 | ||
Acetyltransf_1 | 157..264 | CDD:366181 | 26/151 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0456 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |