DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac2 and NAT8L

DIOPT Version :9

Sequence 1:NP_609889.1 Gene:Atac2 / 35113 FlyBaseID:FBgn0032691 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_848652.2 Gene:NAT8L / 339983 HGNCID:26742 Length:302 Species:Homo sapiens


Alignment Length:205 Identity:44/205 - (21%)
Similarity:72/205 - (35%) Gaps:63/205 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   550 HQKAEILDRYQLLAH-----SRQDARSSF-HARLAGCTQYELFESPYSQRVLHPFIFRSETMAPP 608
            |.:|::|  |.|||.     ||....:.. .|.|.|...|      ||::|:..:          
Human   114 HPRAQLL--YALLAALCFAVSRSLLLTCLVPAALLGLRYY------YSRKVIRAY---------- 160

  Fly   609 WLKLMCELQHRVNGSHPTRSTIDFCFVRPQHIPAVNALLQSTFWPNIDVSECLSYPDYSVVALYK 673
               |.|.|       |...:.|:..:::|   |.      |.||                ||:..
Human   161 ---LECAL-------HTDMADIEQYYMKP---PG------SCFW----------------VAVLD 190

  Fly   674 KLVIGCGFLVPDVGYNEAYISFMAVRPCWQRSGIASFMLYHLIQTCMSKDITLHVSATN----AA 734
            ..|:|..........|...:..|:|...::..|||..:...:::..:..:.:..|..|.    ||
Human   191 GNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAA 255

  Fly   735 VMLYQKFGFK 744
            ..||:..||:
Human   256 HKLYESLGFR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac2NP_609889.1 PHD 14..63 CDD:214584
rimI 639..753 CDD:273701 22/110 (20%)
Acetyltransf_1 676..744 CDD:278980 15/71 (21%)
NAT8LNP_848652.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..72
Acetyltransf_1 157..264 CDD:366181 26/151 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.