DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac2 and Naa20A

DIOPT Version :9

Sequence 1:NP_609889.1 Gene:Atac2 / 35113 FlyBaseID:FBgn0032691 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster


Alignment Length:84 Identity:19/84 - (22%)
Similarity:40/84 - (47%) Gaps:10/84 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   692 YISFMAVRPCWQRSGIASFMLYHLIQTCMSKD---ITLHVSATN-AAVMLYQKFGFKMEEIILDF 752
            :::.:.|.|.::|.|:|:.::..|......|.   :.|.|..:| .|:.:|...|:.:...||::
  Fly    71 HVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGYIIYRTILEY 135

  Fly   753 YDKYLPLDSKQSRNAFFLR 771
            |      ...|..:|:.:|
  Fly   136 Y------SGDQDEDAYDMR 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac2NP_609889.1 PHD 14..63 CDD:214584
rimI 639..753 CDD:273701 15/64 (23%)
Acetyltransf_1 676..744 CDD:278980 13/55 (24%)
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 19/84 (23%)
Acetyltransf_1 51..126 CDD:278980 12/54 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.