DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac2 and CG31730

DIOPT Version :10

Sequence 1:NP_609889.1 Gene:Atac2 / 35113 FlyBaseID:FBgn0032691 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster


Alignment Length:149 Identity:35/149 - (23%)
Similarity:61/149 - (40%) Gaps:37/149 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   642 AVNALLQSTFWPNIDVSECLSYPDYSVVALYKKLVIGCGFLVPD---VGY---------NE---A 691
            |:..:...||:    |...|.:|..|.:|      |..|   ||   :||         |:   .
  Fly    22 ALTEVYSLTFF----VKHFLEFPGLSQIA------IAPG---PDGRPMGYIFGQYQVKRNQDPYG 73

  Fly   692 YISFMAVRPCWQRSGIASFMLYHLIQTCMSKD---ITLHVSATN-AAVMLYQKFGFKMEEIILDF 752
            :::.:.|.|.::|.|:|:.::.........|.   :.|.:..:| ||..||...|:...:..||:
  Fly    74 HVAALTVSPEYRRLGLATALMDFFFMVSDLKGASYVNLFMRISNRAAYQLYTSLGYAHRQTFLDY 138

  Fly   753 YDKYLPLDSKQSRNAFFLR 771
            |.     |..:..:|:.||
  Fly   139 YP-----DEPKPESAYELR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac2NP_609889.1 PHD 14..63 CDD:214584
RimI 678..753 CDD:440224 21/93 (23%)
CG31730NP_723799.1 RimI 57..141 CDD:440224 19/88 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.