Sequence 1: | NP_609889.1 | Gene: | Atac2 / 35113 | FlyBaseID: | FBgn0032691 | Length: | 774 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_543160.1 | Gene: | Nat8f5 / 114020 | RGDID: | 621610 | Length: | 227 | Species: | Rattus norvegicus |
Alignment Length: | 235 | Identity: | 44/235 - (18%) |
---|---|---|---|
Similarity: | 73/235 - (31%) | Gaps: | 94/235 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 559 YQLLAHSRQDARSSFHARLAGCTQYELFESPYSQRVLHPFIFRSETMAPPWLKLMCELQHRVNGS 623
Fly 624 HPTRSTIDFCFVRPQHIPAVNALLQSTFWPNIDVSECLSYPDYSVVAL--------YKKLVIGCG 680
Fly 681 FLVPDV-----GYNEAYISFMAVRPCWQRSGIAS-------------FMLYH------------- 714
Fly 715 --LIQTCMS-------KDITLHVS-ATNAAVMLYQKFGFK 744 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Atac2 | NP_609889.1 | PHD | 14..63 | CDD:214584 | |
rimI | 639..753 | CDD:273701 | 29/155 (19%) | ||
Acetyltransf_1 | 676..744 | CDD:278980 | 22/108 (20%) | ||
Nat8f5 | NP_543160.1 | RimI | <101..196 | CDD:223532 | 19/93 (20%) |
NAT_SF | 108..175 | CDD:173926 | 9/66 (14%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0456 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |