DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10333 and DDX49

DIOPT Version :9

Sequence 1:NP_609888.2 Gene:CG10333 / 35112 FlyBaseID:FBgn0032690 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_061943.2 Gene:DDX49 / 54555 HGNCID:18684 Length:483 Species:Homo sapiens


Alignment Length:398 Identity:132/398 - (33%)
Similarity:207/398 - (52%) Gaps:50/398 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 ESGFPKEIIDIIDKVGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTLAFLIPLLSWIQSLPKI 462
            |.|....:::...::|.|:|||:|...||..|:.||.:|.|:||||||.||::|:|         
Human     6 ELGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPIL--------- 61

  Fly   463 ERLEDVDQGPYAIIMAPTRELAQQIEEETTKFGQPLGIRTVVVVGGLSREEQGFRLRLGCEIVIA 527
            ::|.:...|.:.:::.||||||.||.|:....|:|||::..::|||:....|...|.....:|||
Human    62 QKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIA 126

  Fly   528 TPGRLIDVL-ENRYLVLNQCTYIVLDEADRMIDMG---FEPDVQKILEYMPVTNLKPDTEEAEDE 588
            |||||.|.| .:....:.:..::|:|||||:::.|   |..|::.||..:|..            
Human   127 TPGRLADHLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPAR------------ 179

  Fly   589 TKLMENFYTKKKYRQTVMFTATMPPAVERLARTYLRRP----ATVYIGSVGKPTERTEQIVYMMG 649
                         |||::|:||:...:..|......:|    |...:.:|    |:.:|...::.
Human   180 -------------RQTLLFSATLTDTLRELQGLATNQPFFWEAQAPVSTV----EQLDQRYLLVP 227

  Fly   650 ENDKRKKLMEILSRKIDP----PVIIFVNQKKGADVLAKGLEKLGYNSCTLHGGKGQEQREYALA 710
            |..|...|:.::.|..|.    .:|||.|..|...:|...|.|..:.:..||....|::|..|||
Human   228 EKVKDAYLVHLIQRFQDEHEDWSIIIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALA 292

  Fly   711 ALKSGAKDILVATDVAGRGIDIKDVSLVINYDMAKTIEDYTHRIGRTGRAGKTGCAISFVTKDDS 775
            ..||....||:|||||.||:||..|.:|||::.....:.|.||:|||.|||:.|.||:.||:.|.
Human   293 KFKSSIYRILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLVTQYDI 357

  Fly   776 ALFYDLKQ 783
            .|.:.:::
Human   358 HLVHAIEE 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10333NP_609888.2 DEADc 396..629 CDD:238167 76/238 (32%)
DEXDc 409..632 CDD:214692 74/230 (32%)
Helicase_C 651..761 CDD:278689 43/113 (38%)
DDX49NP_061943.2 SrmB 1..467 CDD:223587 132/398 (33%)
Q motif 2..30 7/23 (30%)
DEAD box 152..155 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.