DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10333 and Hlc

DIOPT Version :9

Sequence 1:NP_609888.2 Gene:CG10333 / 35112 FlyBaseID:FBgn0032690 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_001285517.1 Gene:Hlc / 33118 FlyBaseID:FBgn0001565 Length:560 Species:Drosophila melanogaster


Alignment Length:417 Identity:113/417 - (27%)
Similarity:186/417 - (44%) Gaps:72/417 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 WNESGFPKEIIDIIDKVGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTLAFLIPLLSWIQSLP 460
            ::|....:.|:..:.::|:::||.||..|||:.|:.:|::..|.||||||..:.:||:..|.:  
  Fly    11 FHELELDQRILKAVAQLGWQQPTLIQSTAIPLLLEGKDVVVRARTGSGKTATYALPLIQKILN-- 73

  Fly   461 KIERLEDVDQGPYAIIMAPTRELAQQ----IEEETTKFGQPLGIRTVVVVGGLSREE-----QGF 516
              .:|...:|...|:::|||:||.:|    ||:.....|:      ||.|..::...     |..
  Fly    74 --SKLNASEQYVSAVVLAPTKELCRQSRKVIEQLVESCGK------VVRVADIADSSNDTVTQRH 130

  Fly   517 RLRLGCEIVIATPGRLIDVLENRYLV-LNQCTYIVLDEADRMIDMGFEPDVQKILEYMPVTNLKP 580
            .|....:||:|||..|:...|...:| |.....:|:||||.:...|:|.|.:::::::|      
  Fly   131 ALSESPDIVVATPANLLAYAEAGSVVDLKHVETLVVDEADLVFAYGYEKDFKRLIKHLP------ 189

  Fly   581 DTEEAEDETKLMENFYTKKKYRQTVMFTATMPPAVERLARTYLRRPATVYIGSVG-KPTERTEQI 644
                               ...|.|:.:||:...|.|:....|..|.|:.:.... .|.::....
  Fly   190 -------------------PIYQAVLVSATLTDDVVRMKGLCLNNPVTLKLEEPELVPQDQLSHQ 235

  Fly   645 VYMMGENDKRKKLMEILS-RKIDPPVIIFVNQKKGADVLAKGLEKLGYNSCTLHGGKGQEQREYA 708
            ..:..||||...|..:|. |.|....|||||.......:...||:.|..:|.|:.......|.:.
  Fly   236 RILAEENDKPAILYALLKLRLIRGKSIIFVNSIDRCYKVRLFLEQFGIRACVLNSELPANIRIHT 300

  Fly   709 LAALKSGAKDILVATD-------------------------VAGRGIDIKDVSLVINYDMAKTIE 748
            ::....|..||::|:|                         .|.||||.:.|:.|||:|..:.:.
  Fly   301 ISQFNKGTYDIIIASDEHHMEKPGGKSATNRKSPRSGDMESSASRGIDFQCVNNVINFDFPRDVT 365

  Fly   749 DYTHRIGRTGRAGKTGCAISFVTKDDS 775
            .|.||.|||.|....|..:|||:..:|
  Fly   366 SYIHRAGRTARGNNKGSVLSFVSMKES 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10333NP_609888.2 DEADc 396..629 CDD:238167 65/242 (27%)
DEXDc 409..632 CDD:214692 64/232 (28%)
Helicase_C 651..761 CDD:278689 40/135 (30%)
HlcNP_001285517.1 P-loop_NTPase 11..220 CDD:304359 66/243 (27%)
DEXDc 24..231 CDD:214692 65/241 (27%)
HELICc 234..386 CDD:238034 42/151 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451784
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.