DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10333 and CG5800

DIOPT Version :9

Sequence 1:NP_609888.2 Gene:CG10333 / 35112 FlyBaseID:FBgn0032690 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster


Alignment Length:427 Identity:131/427 - (30%)
Similarity:192/427 - (44%) Gaps:72/427 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 YKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTLAFLIPLLSWIQSLPKIERLEDVDQGPYAIIMA 478
            :..||.:||.:|...||.:|::|.|.||||||||||||:|..: .:.|..|.:.|.    |||::
  Fly    92 FVHPTQVQRDSIGPALQGKDVLGAAITGSGKTLAFLIPVLEHL-FMNKWSRTDGVG----AIIIS 151

  Fly   479 PTRELAQQIEEETTKFGQPLGIRTVVVVGGLSREEQGFRLRLG-CEIVIATPGRLIDVL-ENRYL 541
            ||||||.||.|...|.|:.......:::||.:.:.:  |.|:. |.|:|.|||||:..: ||...
  Fly   152 PTRELAYQIFETLKKVGKHHDFSAGLIIGGKNLKFE--RTRMDQCNILICTPGRLLQHMDENPLF 214

  Fly   542 VLNQCTYIVLDEADRMIDMGFEPDVQKILEYMPVTNLKPDTEEAEDETKLMENFYTKKKYRQTVM 606
            ..:....:|||||||.:||||:..:..|:|..|                         ..|||::
  Fly   215 NTSTMEMLVLDEADRCLDMGFQKTLNSIIENFP-------------------------PVRQTLL 254

  Fly   607 FTATMPPAVERLARTYLRRPATVYIGSVG-----------KPTERT---------EQIVYMMGEN 651
            |:||....|:.|||..|:.|  ||:|..|           |.|..|         :|...::...
  Fly   255 FSATQTNTVQDLARLNLKDP--VYVGYGGATPREEPSASTKKTPNTAVLAVPELLQQSYVVLNLE 317

  Fly   652 DKRKKLMEILSRKIDPPVIIFVNQKKGADVLAKGLEKL--GYNSCTLHGGKGQEQREYALAALKS 714
            ||...|...:...:...:|:||...|.|..|.:...||  |.....|:|...|::|.........
  Fly   318 DKITMLWSFIKNHLKQKIIVFVASCKQAKYLYEIFCKLRPGSPLLALYGTLHQDRRIAIYEDFLR 382

  Fly   715 GAKDILVATDVAGRGIDIKDVSLVINYDMAKTIEDYTHRIGRTGRAGKTG-CAISFVTKDDSALF 778
            .:..::.:||||.||:|...|:.|:..|..:.:..|.||.||:.|....| |.:.....::..:.
  Fly   383 KSHVVMFSTDVASRGLDFPAVNWVVQLDCPEDVSQYIHRAGRSARNKTRGECLLVLTPSEEEYMI 447

  Fly   779 YDLKQ-------CVSASPVSTCPPE------LMNHPE 802
            ..||:       ||...|.....|.      |...||
  Fly   448 SALKEQLNIDIRCVQIDPKKLFSPRVKIEAFLAQFPE 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10333NP_609888.2 DEADc 396..629 CDD:238167 80/216 (37%)
DEXDc 409..632 CDD:214692 82/219 (37%)
Helicase_C 651..761 CDD:278689 32/111 (29%)
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 127/412 (31%)
DEADc 74..277 CDD:238167 81/218 (37%)
HELICc 311..437 CDD:238034 34/125 (27%)
DUF4217 474..530 CDD:290667 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451451
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.