DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10333 and mahe

DIOPT Version :9

Sequence 1:NP_609888.2 Gene:CG10333 / 35112 FlyBaseID:FBgn0032690 Length:822 Species:Drosophila melanogaster
Sequence 2:NP_001284994.1 Gene:mahe / 31707 FlyBaseID:FBgn0029979 Length:945 Species:Drosophila melanogaster


Alignment Length:516 Identity:185/516 - (35%)
Similarity:277/516 - (53%) Gaps:78/516 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 NNLYKERHHVQFFGRGNVAGIDIKEQKRTQSKFY-----GDLLEKRRTEAEKEQEKVRLKKMKRK 349
            |..|.:|:.....|.|...|.        ||..|     |.|.::.|.|.::|    :.|...|.
  Fly   133 NPTYAQRYQKPNNGAGVAGGY--------QSNNYNAAALGMLSKEERAEIQRE----KAKNPGRN 185

  Fly   350 EDKQKWDD------------RHWSEKENDEMTERDWRIFREDYNVTIKGGRIPNPIRSWNESGFP 402
            ..|.||::            .:...|...::.|     .|.:..:|:.|..:|:|:.|:.||..|
  Fly   186 LVKPKWENLEPFLKDFYNIHPNTLAKSEQQVAE-----IRRELEITVSGNELPHPVVSFEESSLP 245

  Fly   403 KEIIDIIDKVGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTLAFLIPLLSWIQSLPKIERLED 467
            ..:|:.:.:.|:.:||.||.|..||.|..||::|:|:||||||||:::|.:..|.:.|.|.|   
  Fly   246 AHVIEEMKRQGFTKPTAIQSQGWPIALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQPPIIR--- 307

  Fly   468 VDQGPYAIIMAPTRELAQQIEEETTKFG---QPLGIRTVVVVGGLSREEQGFRLRLGCEIVIATP 529
             .:||.|:::||||||||||:.....:|   :| .||...:.||.|:..|...|..|.|::||||
  Fly   308 -GEGPIALVLAPTRELAQQIQSVVRDYGHLCKP-EIRHTCIFGGSSKVPQARDLDRGVEVIIATP 370

  Fly   530 GRLIDVLENRYLVLNQCTYIVLDEADRMIDMGFEPDVQKILEYMPVTNLKPDTEEAEDETKLMEN 594
            |||||.||||...|.:|||:||||||||:||||||.::||:|     .::||             
  Fly   371 GRLIDFLENRNTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE-----QIRPD------------- 417

  Fly   595 FYTKKKYRQTVMFTATMPPAVERLARTYLRRPATVYIGSVG-KPTERTEQIVYMMGENDKRKKLM 658
                   ||.||::||.|..|:.||..:|.....:.|||:. .......|||.:..|.:|.::|:
  Fly   418 -------RQVVMWSATWPKEVQALAGDFLNDYIQINIGSMNLSANHNIRQIVEICTEIEKPQRLV 475

  Fly   659 EILSRKIDP---------PVIIFVNQKKGADVLAKGLEKLGYNSCTLHGGKGQEQREYALAALKS 714
            .:|: :|.|         .:|:||..|...:.:.:.:...|||:.::||.|.|.:|:..|...::
  Fly   476 CLLN-EISPIKNSGNNGNKIIVFVETKIKVEDILQIIRAEGYNATSIHGDKTQNERDSVLKDFRN 539

  Fly   715 GAKDILVATDVAGRGIDIKDVSLVINYDMAKTIEDYTHRIGRTGRAGKTGCAISFVTKDDS 775
            |..:||:|||||.||:|::|:..|||||...:.|:|.||||||||..:.|.|.:|.|.|::
  Fly   540 GKSNILIATDVASRGLDVEDLQYVINYDYPNSSENYVHRIGRTGRCQQLGTAYTFFTPDNA 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10333NP_609888.2 DEADc 396..629 CDD:238167 101/235 (43%)
DEXDc 409..632 CDD:214692 97/225 (43%)
Helicase_C 651..761 CDD:278689 45/118 (38%)
maheNP_001284994.1 PTZ00110 136..656 CDD:240273 184/513 (36%)
DEADc 239..446 CDD:238167 101/236 (43%)
HELICc 457..594 CDD:238034 51/137 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451767
Domainoid 1 1.000 102 1.000 Domainoid score I343
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D183201at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9750
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.