DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10413 and LOC1279673

DIOPT Version :10

Sequence 1:NP_609887.1 Gene:CG10413 / 35111 FlyBaseID:FBgn0032689 Length:941 Species:Drosophila melanogaster
Sequence 2:XP_319440.4 Gene:LOC1279673 / 1279673 VectorBaseID:AGAMI1_014541 Length:939 Species:Anopheles gambiae


Alignment Length:46 Identity:15/46 - (32%)
Similarity:18/46 - (39%) Gaps:17/46 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSLPASQNEA-----------LVGP-----ALEVQEVDAFNPQDPQ 43
            |:|.|.:..|           :.||     .||||.||. |...||
Mosquito    80 LALDADKENADGLRGQSFSLVIAGPKKSRATLEVQIVDV-NDNSPQ 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10413NP_609887.1 AA_permease_2 22..932 CDD:459263 12/38 (32%)
LOC1279673XP_319440.4 None

Return to query results.
Submit another query.