DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and neurod6

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001072273.1 Gene:neurod6 / 779726 XenbaseID:XB-GENE-969227 Length:337 Species:Xenopus tropicalis


Alignment Length:123 Identity:43/123 - (34%)
Similarity:56/123 - (45%) Gaps:33/123 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GKNQGRSPRYWNKQQ----------------RSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVL 136
            ||:..|||....:|:                |..|..|..|.:..                 |.:
 Frog    45 GKHIKRSPEEETEQEEEDEDREEEDENGLPRRRGPRKKKMTKVRI-----------------ERI 92

  Fly   137 KKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLL 194
            |.||:.||||||.||:.||||.|.||.|||.....::|||.|||::|:.||..|..:|
 Frog    93 KVRRVEANARERGRMHGLNDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEIL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 33/63 (52%)
neurod6NP_001072273.1 bHLH_TS_NeuroD4_ATOH3 74..151 CDD:381564 37/94 (39%)
Neuro_bHLH 153..272 CDD:463621
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.