DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and olig4

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001039180.1 Gene:olig4 / 734024 XenbaseID:XB-GENE-484736 Length:209 Species:Xenopus tropicalis


Alignment Length:108 Identity:35/108 - (32%)
Similarity:51/108 - (47%) Gaps:24/108 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NQGRSPRYWNKQ--------QRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVLKKRRLAANAR 146
            ::|.||::.:..        ||..|..::.......|.              |...:.||..|:|
 Frog    16 DRGESPQFLSGAMFQAHSVGQRMPPRGRVKAGKRELTQ--------------ENQHELRLKVNSR 66

  Fly   147 ERRRMNSLNDAFDKLRDVVP-SLGHD-RRLSKYETLQMAQAYI 187
            ||:||:.||.|.|.||:|:| |.|.. |:|||..||.:|:.||
 Frog    67 ERQRMHDLNQAMDGLREVMPYSHGPSVRKLSKISTLILARNYI 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 27/53 (51%)
olig4NP_001039180.1 bHLH_TS_OLIG2_like 59..121 CDD:381568 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.