DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and TCF15

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_004600.3 Gene:TCF15 / 6939 HGNCID:11627 Length:199 Species:Homo sapiens


Alignment Length:70 Identity:31/70 - (44%)
Similarity:45/70 - (64%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 SSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGD 189
            :....|.|..|:.::|.|||||||.|..|:|.||..||.::|:...||:|||.||:::|.:||..
Human    59 AGGGGGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETVRLASSYIAH 123

  Fly   190 LVTLL 194
            |..:|
Human   124 LANVL 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 30/63 (48%)
TCF15NP_004600.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..67 1/7 (14%)
bHLH_TS_TCF15_paraxis 66..131 CDD:381476 30/63 (48%)

Return to query results.
Submit another query.