DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and TAL2

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_005412.1 Gene:TAL2 / 6887 HGNCID:11557 Length:108 Species:Homo sapiens


Alignment Length:56 Identity:26/56 - (46%)
Similarity:38/56 - (67%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 RRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLL 194
            |::..|.|||.|..::|.||.|||.::|:...|::|||.|||::|..||..||.:|
Human     3 RKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVL 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 26/56 (46%)
TAL2NP_005412.1 bHLH_TS_TAL2 2..62 CDD:381550 26/56 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..108
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.