DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and TAL1

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_047285001.1 Gene:TAL1 / 6886 HGNCID:11556 Length:390 Species:Homo sapiens


Alignment Length:95 Identity:30/95 - (31%)
Similarity:46/95 - (48%) Gaps:18/95 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 QQRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVV 165
            ::|..||:...|.                  |......||:..|:|||.|..::|.||.:||.::
Human   227 KRRPSPYEMEITD------------------GPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLI 273

  Fly   166 PSLGHDRRLSKYETLQMAQAYIGDLVTLLS 195
            |:...|::|||.|.|::|..||..|..||:
Human   274 PTHPPDKKLSKNEILRLAMKYINFLAKLLN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 25/62 (40%)
TAL1XP_047285001.1 bHLH_TS_TAL1 244..308 CDD:381549 25/60 (42%)

Return to query results.
Submit another query.