DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Neurog3

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_067732.1 Gene:Neurog3 / 60329 RGDID:631350 Length:214 Species:Rattus norvegicus


Alignment Length:189 Identity:52/189 - (27%)
Similarity:76/189 - (40%) Gaps:62/189 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PDEAPAIPEFLSNDTFQQLEQLMYQQEF-STSDSQSDGANSCSLEMYYDTPSVLELEHMLNAQEQ 77
            |.:||.|.  :|.:|         ||.| ..||.:...:||..     .:|:::..:    ..|.
  Rat     5 PLDAPTIQ--VSQET---------QQPFPGASDHEVLSSNSTP-----PSPTLVPRD----CSEA 49

  Fly    78 Q-------QHHLQANPLGKNQGRSPRYWNKQQRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEV 135
            :       ...|:|...|:|:.:|....:||:||                               
  Rat    50 EAGDCRGTSRKLRARRGGRNRPKSELALSKQRRS------------------------------- 83

  Fly   136 LKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLL 194
               ||..||.|||.||::||.|.|.||.|:|:...|.:|:|.|||:.|..||..|...|
  Rat    84 ---RRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLTKIETLRFAHNYIWALTQTL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 28/58 (48%)
Neurog3NP_067732.1 bHLH_TS_NGN3_ATOH5 77..144 CDD:381561 32/97 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339111
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.