DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Bhlhe22

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_067535.3 Gene:Bhlhe22 / 59058 MGIID:1930001 Length:355 Species:Mus musculus


Alignment Length:74 Identity:35/74 - (47%)
Similarity:43/74 - (58%) Gaps:9/74 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 SSSSSSSAGFGGEVLKKR-----RLAANARERRRMNSLNDAFDKLRDVVPSLGHD---RRLSKYE 178
            :|...|..|.||...|.:     ||..||||||||:.||||.|:||.|:| ..|.   |:|||..
Mouse   195 TSGGGSGGGGGGSSKKSKEQKALRLNINARERRRMHDLNDALDELRAVIP-YAHSPSVRKLSKIA 258

  Fly   179 TLQMAQAYI 187
            ||.:|:.||
Mouse   259 TLLLAKNYI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 32/64 (50%)
Bhlhe22NP_067535.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..90
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..215 6/19 (32%)
bHLH_TS_bHLHe22_bHLHb5 217..286 CDD:381524 29/52 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.