powered by:
Protein Alignment amos and Bhlhe22
DIOPT Version :9
Sequence 1: | NP_477446.1 |
Gene: | amos / 35110 |
FlyBaseID: | FBgn0003270 |
Length: | 198 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_067535.3 |
Gene: | Bhlhe22 / 59058 |
MGIID: | 1930001 |
Length: | 355 |
Species: | Mus musculus |
Alignment Length: | 74 |
Identity: | 35/74 - (47%) |
Similarity: | 43/74 - (58%) |
Gaps: | 9/74 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 122 SSSSSSSAGFGGEVLKKR-----RLAANARERRRMNSLNDAFDKLRDVVPSLGHD---RRLSKYE 178
:|...|..|.||...|.: ||..||||||||:.||||.|:||.|:| ..|. |:|||..
Mouse 195 TSGGGSGGGGGGSSKKSKEQKALRLNINARERRRMHDLNDALDELRAVIP-YAHSPSVRKLSKIA 258
Fly 179 TLQMAQAYI 187
||.:|:.||
Mouse 259 TLLLAKNYI 267
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167835476 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.