DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and atoh7

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_571707.1 Gene:atoh7 / 58216 ZFINID:ZDB-GENE-000926-1 Length:134 Species:Danio rerio


Alignment Length:81 Identity:44/81 - (54%)
Similarity:54/81 - (66%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 SSSTSSASSSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYET 179
            |.:.|.:.|.|.....|  |...:||:|||||||:||..||.|||:||.|||..|.|::||||||
Zfish     7 SCADSGSDSDSRDPEKF--ESAMRRRMAANARERKRMQGLNTAFDRLRKVVPQWGQDKKLSKYET 69

  Fly   180 LQMAQAYIGDLVTLLS 195
            ||||.:||..|..:||
Zfish    70 LQMALSYIMALNRILS 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 36/57 (63%)
atoh7NP_571707.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 6/21 (29%)
HLH 29..80 CDD:278439 35/50 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578674
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003687
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 1 1.000 - - X5408
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.